SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000089009 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000089009
Domain Number 1 Region: 589-701
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-36
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1390-1506
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-36
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 3 Region: 931-1042
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-35
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 4 Region: 2688-2799
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-35
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 5 Region: 1625-1733
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-34
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 6 Region: 3154-3279
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-34
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 7 Region: 1053-1159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-34
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 8 Region: 1164-1275
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-33
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 9 Region: 3401-3506
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 10 Region: 2228-2335
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-32
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 11 Region: 1738-1848
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-31
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 12 Region: 2335-2446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-31
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 13 Region: 3036-3148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-31
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 14 Region: 1278-1387
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-31
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 15 Region: 2452-2564
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-30
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 16 Region: 1509-1617
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-30
Family Spermadhesin, CUB domain 0.00092
Further Details:      
 
Domain Number 17 Region: 1987-2090
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-28
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 18 Region: 2091-2212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-28
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 19 Region: 1857-1964
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-27
Family Spermadhesin, CUB domain 0.00072
Further Details:      
 
Domain Number 20 Region: 3510-3622
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-27
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 21 Region: 824-927
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-27
Family Spermadhesin, CUB domain 0.00099
Further Details:      
 
Domain Number 22 Region: 474-585
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-27
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 23 Region: 2920-3033
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-25
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 24 Region: 708-815
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-23
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 25 Region: 2570-2686
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-23
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 26 Region: 2804-2917
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-21
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 27 Region: 3286-3394
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-19
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 28 Region: 130-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000113
Family EGF-type module 0.018
Further Details:      
 
Domain Number 29 Region: 432-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000197
Family EGF-type module 0.012
Further Details:      
 
Domain Number 30 Region: 300-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000699
Family EGF-type module 0.017
Further Details:      
 
Domain Number 31 Region: 259-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000246
Family EGF-type module 0.017
Further Details:      
 
Domain Number 32 Region: 392-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family EGF-type module 0.013
Further Details:      
 
Domain Number 33 Region: 167-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000587
Family EGF-type module 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000089009
Domain Number - Region: 350-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00063
Family EGF-type module 0.085
Further Details:      
 
Domain Number - Region: 224-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0348
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000089009   Gene: ENSMUSG00000026726   Transcript: ENSMUST00000091436
Sequence length 3623
Comment pep:known chromosome:GRCm38:2:13276338:13491924:-1 gene:ENSMUSG00000026726 transcript:ENSMUST00000091436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASHFLWGFVTLLMVPGLDGETGTPEQKLQKRIADLHQPRMTTEEGNLVFLTSSAQNIEF
RTGSLGKIKLNDDDLGECLHQIQRNKDDIIDLKRNTTGLPQNILSQVHQLNSKLVDLERD
FQSLQQNVERKVCSSNPCHNGGTCVNLHDSFICICPSQWKGLFCSEDVNECVLYAGTPFG
CQSGSTCVNTMGSFRCDCTPDTYGPQCASKYNDCEQGSQQLCKHGICEDLQRVYHGQLRF
NCICDAGWTTLPNGISCTEDKDECSLQPSPCSEHAQCFNTQGSFYCGACPKGWQGNGYQC
QDINECEINNGGCSQAPLVPCLNTPGSFTCGNCPAGFSGDGRVCTPLDICSIHNGGCHPD
ATCSSSSVLGSLLPVCTCPPGYTGNGYGSNGCVRLSNMCSRHPCVNGQCIETVSSYFCKC
DSGWFGQNCTENINECVSNPCLNGGTCIDGVNGFTCDCTSSWTGYYCQTPQAACGGILSG
TQGTFAYQSPNDTYVHNVNCFWVVRTDEEKVLHITFTFFDLESASNCPREYLQIHDGDSS
ADFPLGRYCGSTPPQGVHSSANSLYFHLYSEYIKRGRGFTARWEAKLPECGGILTGNYGS
ITSPGYPGNYPPGRDCVWNLLVSPGSLITFTFGTLSLESHNDCSKDYLEIRDGPFHHDPI
LGKFCTSLSTPPLQTTGPAARIHFHSDSETSDKGFHITYLTTPSDLYCGGNYTDTEGELL
LPPLTGPFSHSRQCVYLISQPQGEQIVINFTHVELESQRGCSHTFIEVGDHESLLRKICG
NETLFPIRSISNNVWIRLRIDALVQKASFRADYQVACGGELRGEGVIRSPFYPNAYAGRR
TCRWTISQPPREVVLLNFTDFQIGSSSSCDTDYIEIGPSSVLGSPGNEKFCGTNIPSFIT
SVYNVLYVTFVKSSSMENRGFMAMFSSEKLECGKVLTESTGIIESPGHPNVYPSGVNCTW
HIVVQRGQLIRLVFSSFYLEFHYNCANDYLEVYDTIAQTSLGRYCGKSIPPSLTSSSHSI
KLIFVSDSALAHEGFSINYEAINASSVCLYDYTDNFGRLSSPNFPNNYPHNWNCVYRITV
GLNQQIALHFTDFALEDYFGPKCVDFVEIRDGGFETSPLIGIYCGSVFPPRIISHSNKLW
LRFKSDTALTARGFSAYWDASSTGCGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEASRG
SPFLLEFQDFHLEHHPNCSLDYLAVFDGPSTNSRLINKLCGDTPPAPIRSSKDIVLLKLR
TDAGQQGRGFEINYRQTCDNVVIVNKTSGILESINYPNPYDKDQRCNWTIQATTGNTVNY
TFLEFDVENYVNCSTDYLELYDGPQRIGRYCGENIPPPGATTGSKLIVVFHTDGVDSGEK
GFKMHWFIHGCGGEMSGTMGSFSSPGYPNSYPHNKECIWNIRVAPGNSIQLTIHDFDVEY
HASCKYDTLEIYTGLDFHSPRIAQLCSRSPSANPMQISSTDNELAIRFKTDSSLNGRGFN
ASWRAVPGGCGGIFQVSRGEIHSPNYPNNYRANTECSWIIQVEKYHRVLLNITDFDLEAT
DSCLMTYDGSSSANTRVATVCGRQQPPNSITSSGNSLFVRFQSGSSSQSRGFRAQFRQEC
GAHIITDSSDSISSPLYPANYPNNQNCTWIIEAQPPFNHIALSFTHFHLQSSTDCTRDFV
EILDGRDSDAPVQGRYCGTSLPHPIISFGNALTVRFVSDSVYGFDGFHAIYSASTSACGG
TFYTGDGIFNSPGYPEDYHSNTECVWNIASSPGNHLQLSFLSFQLENSLNCNKDFVEIRE
GNATGHLMGRYCGNSLPGNYSSIEGHNLWVRFVSDGSGTGMGFQARFKNIFGNDNIVGTH
GKIATPFWPGNYPLNSNYRWTVNVDSSHIIHGRILEMDIELTTNCFYDSLKIYDGFDIHS
RLIGTYCGTQRESFSSSRNSLTFQFSSDSSKSGRGFLLEWFAVDVSNVTLPTIAPGACGG
YMVTGDTPVFFFSPGWPGPYGNGADCIWIIYAPDSTVELNILSMDIEAQLSCSYDKLIIK
DGDSRLSQQLAVLCGRSVPGPIRSTGEYMYIRFTSDGSVTGAGFNASFQKSCGGYLHADR
GIITSPKYPDNYLPNLNCSWHVLVQSGLTIAVHFEQPFQIQNRDSSCSQGDYLVLRNGPD
NHSPPLGPSGGNGRFCGIYTPSTLFTSDNEMFIQFISDNSNGGQGFKIRYEAKSLACGGT
IYIHDANSDGYVTSPNYPANYPQHAECIWILEAPSGRSIQLQFEDQFNIEETPNCSASYL
ELRDGANSNAPVLSKLCGHTLPRNWVSSRGLMYLKFHTEGGSGYMGFKAKYSIVSCGGTV
SGDSGVIESVGYPTRLYANNVFCQWHIQGLPGHYLTIRFEDFNLQSSPGCAKDFVEIWEN
HTSGILLGRYCGNSIPSSVDTSSNVASIRFVTDGSVTDSGFRLQFKSSREVCGGDLHGPT
GTFTSPNYPNPNPHPRICEWTINVHEGRQIILTFTNLRLSTQQSCNTEHLIVFNGIRNNS
PRLQKLCSRVNVTNEFKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGTLPSVSGG
NFSSPGYNGIRDYARNLDCEWTLSNPNRENSSISIHFLGLSLESHQDCTFDVLEFRVGNA
DGPLIEKFCSLSAPRVPLVIPYPQVWIHFVSNERVEYTGFYVEYSFTNCGGIQTGENGVI
SSPNYPNLYSRWTQCSWLLEAPEGHTITLTFSDFSVENHPTCTSDSVTVRNGDSPGSPII
GRYCGQSVPGPIQSGSNQLVVTFNTNNQGQSRGFYATWNTNTLGCGGTLHSDNGTIKSPH
WPQTFPENSRCSWTAVTHESKHWEISFDSNFRIPSSDSQCRNSFVKVWEGMLETNDALLA
TSCGNVAPSPIVTLGNIFTAVFQSEEMPAQGFSASFISRCGRTFNSSTGDIVSPNFPKHY
DNNMNCNYYIDVAPQSLVILTFVSFHLEDRSAVSGTCDYDGLHIIKGHNLSSTPLVTICG
SETLRPLTIDGPVMLNFYSDAYITDFGFKISYRVANCGGIYSGTYGVLNSPSFSYTNYPN
NVYCVYSLQVRNDRLILLRFNDFEIVPSNLCSHDYLEVFDGPSIGNRSIGKFCGSTLPQV
IKSTNNSLTLLFKTDSSQTARGWKVSFRETIGPQQGCGGYLTEDSKSFVSPDHDSDGLYD
KGLNCIWYIIAPENKLVKLTFNAFTLEEPSSPGKCTFDYVQIADGASINSYLGGRFCGSS
RPAPFISSGNFLTVQFVSDISIQMRGFNATYTFVDMPCGGTYNATSMPQNTSSPQLSNIR
RPFSTCTWVIEAPPHQQVQITVWKLQLPSQDCSRSSLELQDSEQTNGNQVTQFCGANYTT
LPVFYSSGSTAVVVFKSDFLNRNSRVHFTYEIADCNREYNQAFGNLKSPGWPQGYANNLD
CSIILRAPQNHRISLFFYWFQLEDSRQCMNDFLEVRNGSSSSSPLLGKYCSNLLPNPIFS
QSNELYLHFHSDDSDTHHGYEIIWASSPTGCGGTLLGNEGILANPGFPDSYPNNTHCEWT
IVAPSGRPLSVGFPFLSIDSPGGCDQNYLILFNGPDANSPPFGPFCGIDTVVAPFHASSN
RVFIRFHAEYATVSSGFEIMWSS
Download sequence
Identical sequences Q9JLB4
NP_001074553.1.92730 10090.ENSMUSP00000089009 ENSMUSP00000089009 ENSMUSP00000089009 ENSMUSP00000089009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]