SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000089036 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000089036
Domain Number 1 Region: 149-404
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.05e-70
Family Nuclear receptor ligand-binding domain 0.00000774
Further Details:      
 
Domain Number 2 Region: 81-161
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.05e-31
Family Nuclear receptor 0.0000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000089036   Gene: ENSMUSG00000069171   Transcript: ENSMUST00000091458
Sequence length 420
Comment pep:known chromosome:GRCm38:13:78188973:78199757:-1 gene:ENSMUSG00000069171 transcript:ENSMUST00000091458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGEQQQAGSGAPHTPQTPGQPGAPAT
PGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCR
ANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHC
YLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDL
QITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQ
EQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQ
PSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS
Download sequence
Identical sequences F2Z3S9 Q32NY6
ENSRNOP00000020044 ENSMUSP00000089036 ENSMUSP00000089036 NP_034281.2.92730 XP_005356597.1.66349 XP_021063924.1.100879 ENSRNOP00000020044 ENSMUSP00000089036 10090.ENSMUSP00000089036 10116.ENSRNOP00000020044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]