SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000089053 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000089053
Domain Number 1 Region: 215-459
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.73e-72
Family Nuclear receptor ligand-binding domain 0.000000000284
Further Details:      
 
Domain Number 2 Region: 105-194
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.34e-28
Family Nuclear receptor 0.00000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000089053   Gene: ENSMUSG00000021779   Transcript: ENSMUST00000091471
Sequence length 461
Comment pep:known chromosome:GRCm38:14:17660960:18038088:1 gene:ENSMUSG00000021779 transcript:ENSMUST00000091471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPNSMTENGLPAWDKQKPRPDRGQDWKLVGMSEACLHRKSHVERRGALKNEQTSPHLIQ
ATWTSSIFHLDPDDVNDQSISSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKSLHPSYSCKYEGKCIIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPDSETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences P37242
NP_001106888.1.92730 XP_006518029.1.92730 XP_006518030.1.92730 XP_006518031.1.92730 XP_006518033.1.92730 XP_006518034.1.92730 XP_006518035.1.92730 XP_011243039.1.92730 XP_011243040.1.92730 XP_011243041.1.92730 XP_011243042.1.92730 XP_011243043.1.92730 XP_011243044.1.92730 XP_011243045.1.92730 XP_017171435.1.92730 XP_017171436.1.92730 ENSMUSP00000022303 ENSMUSP00000089053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]