SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000090304 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000090304
Domain Number 1 Region: 2765-2929
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.73e-38
Family Laminin G-like module 0.0000000328
Further Details:      
 
Domain Number 2 Region: 2934-3116
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.77e-33
Family Laminin G-like module 0.0000000106
Further Details:      
 
Domain Number 3 Region: 2333-2520
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.03e-31
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 2516-2708
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.48e-26
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 5 Region: 2147-2324
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.18e-24
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 811-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000024
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 372-393,436-534,719-734
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000392
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 861-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 9 Region: 1416-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 10 Region: 1473-1525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 11 Region: 914-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000187
Family Laminin-type module 0.004
Further Details:      
 
Domain Number 12 Region: 283-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 13 Region: 753-805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 14 Region: 1056-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 15 Region: 963-1012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000159
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 16 Region: 1010-1053
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 17 Region: 1837-2067
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000123
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0071
Further Details:      
 
Domain Number 18 Region: 1523-1562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 19 Region: 85-164
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000935
Family APC10-like 0.053
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000090304
Domain Number - Region: 1374-1402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000184
Family Laminin-type module 0.042
Further Details:      
 
Domain Number - Region: 1119-1159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family Laminin-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000090304   Gene: ENSMUSG00000019899   Transcript: ENSMUST00000092639
Sequence length 3118
Comment pep:known chromosome:GRCm38:10:26981285:27616843:-1 gene:ENSMUSG00000019899 transcript:ENSMUST00000092639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAATAGILLLLLLGTLEGSQTQRRQSQAHQQRGLFPAVLNLASNALITTNATCGEKGPE
MYCKLVEHVPGQPVRNPQCRICNQNSSNPYQRHPITNAIDGKNTWWQSPSIKNGVEYHYV
TITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYP
RTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARYIRLR
FQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPATNK
SRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNCHGKAEECYYDETVASRNL
SLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTGSLSE
VCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYPDCQPCNCSGLGSTNEDPCVG
PCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECFCSGVSNRCQSSYWTYGNIQDMRGWY
LTDLSGRIRMAPQLDNPDSPQQISISNSEARKSLLDGYYWSAPPPYLGNRLPAVGGQLSF
TISYDLEEEEDDTEKILQLMIIFEGNDLRISTAYKEVYLEPSEEHIEEVSLKEEAFTIHG
TNLPVTRKDFMIVLTNLERVLMQITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVC
QCPPGYSGSSCETCWPRHRRVNGTIFGGICEPCQCFAHAEACDDITGECLNCKDHTGGPY
CNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRC
ERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADG
YFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQLGRGC
LPCNCNSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCSHLGNNCD
PKTGQCICPPNTTGEKCSECLPNTWGHSIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPK
FSGMKCSECSRGHWNYPLCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVH
CDRCRPGKFGLDAKNPLGCSSCYCFGVTSQCSEAKGLIRTWVTLSDEQTILPLVDEALQH
TTTKGIAFQKPEIVAKMDEVRQELHLEPFYWKLPQQFEGKKLMAYGGKLKYAIYFEARDE
TGFATYKPQVIIRGGTPTHARIITRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRISRTV
TREDFLDILYDIHYILIKATYGNVVRQSRISEISMEVAEPGHVLAGSPPAHLIERCDCPP
GYSGLSCETCAPGFYRLRSEPGGRTPGPTLGTCVPCQCNGHSSQCDPETSVCQNCQHHTA
GDFCERCALGYYGIVRGLPNDCQPCACPLISPSNNFSPSCVLEGLEDYRCTACPRGYEGQ
YCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGCEHWH
AREGAECVFCGDECTGLLLGDLARLEQMTMNINLTGPLPAPYKILYGLENTTQELKHLLS
PQRAPERLIQLAEGNVNTLVMETNELLTRATKVTADGEQTGQDAERTNSRAESLEEFIKG
LVQDAEAINEKAVQLNETLGNQDKTAERNLEELQKEIDRMLKELRSKDLQTQKEVAEDEL
VAAEGLLKRVNKLFGEPRAQNEDMEKDLQQKLAEYKNKLDDAWDLLREATDKTRDANRLS
AANQKNMTILETKKEAIEGSKRQIENTLKEGNDILDEANRLLGEINSVIDYVDDIKTKLP
PMSEELSDKIDDLAQEIKDRRLAEKVFQAESHAAQLNDSSAVLDGILDEAKNISFNATAA
FRAYSNIKDYIDEAEKVAREAKELAQGATKLATSPQGLLKEDAKGSLQKSFRILNEAKKL
ANDVKGNHNDLNDLKTRLETADLRNSGLLGALNDTMDKLSAITNDTAAKLQAVKEKAREA
NDTAKAVLAQVKDLHQNLDGLKQNYNKLADSVAKTNAVVKDPSKNKIIADAGTSVRNLEQ
EADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCVRTYRPEIKK
GSYNNIVVHVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTI
DDSYWYRIEASRTGRNGSISVRALDGPKASMVPSTYHSVSPPGYTILDVDANAMLFVGGL
TGKIKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGTIQFD
GEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLKDFMSVELSDGHVKVSYDL
GSGMTSVVSNQNHNDGKWKAFTLSRIQKQANISIVDIDSNQEENVATSSSGNNFGLDLKA
DDKIYFGGLPTLRNLSMKARPEVNVKKYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLE
NVYTVSFPKPGFVELAAVSIDVGTEINLSFSTRNESGIILLGSGGTLTPPRRKRRQTTQA
YYAIFLNKGRLEVHLSSGTRTMRKIVIKPEPNLFHDGREHSVHVERTRGIFTVQIDEDRR
HMQNLTEEQPIEVKKLFVGGAPPEFQPSPLRNIPAFQGCVWNLVINSIPMDFAQPIAFKN
ADIGRCTYQKPREDESEAVPAEVIVQPQPVPTPAFPFPAPTMVHGPCVAESEPALLTGSK
QFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPY
FSYDLGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGI
LYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGTCFANAESGTYF
DGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNG
AGRFTAIYDAGIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPV
FVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT
Download sequence
Identical sequences Q60675
ENSMUSP00000090304 ENSMUSP00000090304 NP_032507.2.92730 ENSMUSP00000090304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]