SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000090395 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000090395
Domain Number 1 Region: 167-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 447-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.91e-24
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 4 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.15e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-22
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 601-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 10 Region: 3-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-20
Family KRAB domain (Kruppel-associated box) 0.00033
Further Details:      
 
Domain Number 11 Region: 111-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.48e-19
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 12 Region: 63-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000151
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000090395   Gene: ENSMUSG00000072763   Transcript: ENSMUST00000092720
Sequence length 667
Comment pep:novel chromosome:GRCm38:5:109674545:109691041:-1 gene:ENSMUSG00000072763 transcript:ENSMUST00000092720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALTYDDVYVNFTREEWALLNPSQKSLYKDVMLENYTNLIAVGNNWEDSNIEEHCESSR
RHGRHERSLTGEKPSENTQCGKAFACHSYLQRYERIHTGEKPYEGIQYGEAFVHHSSLQM
NKKIPTGKKPYKCNQCGKAFTGHSHLQMHKIRHSGETPYKCDQCGKAFKCQNNLKRHERI
HTGEKPYKCDQCGKAFKCQNNLKRHERIHTGEKPYKCNECGKAFVRNASLQEHNATHTGV
KPYKCNQCGKAFASHSQLQKHERIHTEEKPYKCKQCGKAFAFHSYLQVHKRTHTGEKPYE
CDQCDKAFANQRSFQVHKRIHTGEKPYKCDQCGKAFAYHKCLQQHNRTHTGEKPYECNQC
GKTFAHHSNLQLHKRRHTGEKPYECKQCSKSFASHGQLQKHERIHTGEKPYKCNECGKAF
VRNASLQEHKATHSGVKPYECNQCGKAFASHGQLQKHERIHTGEKPYKCNECGKAFAFHS
YLQVHQRTHTGEKPYECDQCGKAFAYQSSFQEHKRIHTGEKPYKCDQCGKAFAYHKCLQL
HNRTHTGEKPYECNQCGKTFAHHSDLQLHKRRHTGEKPYECKQCSKSFASRAKLRKHDRI
HTGEKPYKCDQCGKAFAYHSYLQVHKRIHTGEKPYECNQCGKAFTYRSYLQVHKRTHIEL
GSVGACL
Download sequence
Identical sequences D3Z5L4
ENSMUSP00000090395 10090.ENSMUSP00000090395 ENSMUSP00000090395 ENSMUSP00000090395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]