SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000092053 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000092053
Domain Number 1 Region: 496-737
Classification Level Classification E-value
Superfamily VPS9 domain 2.88e-54
Family VPS9 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 48-169
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-17
Family SH2 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 754-833
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000956
Family Ras-binding domain, RBD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000092053   Gene: ENSMUSG00000001768   Transcript: ENSMUST00000094480
Sequence length 858
Comment pep:known chromosome:GRCm38:2:145786116:145887616:1 gene:ENSMUSG00000001768 transcript:ENSMUST00000094480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFCILSMVRHKDGGYSEDKDGKTCPRDSGYDSLSNRLSILDRLLHTHPIWLQLSLSEE
EAAEVLQAQPPGIFLVRKSSKMQKKVLSLRLPCEFGAPLKEFTIKESTYTFSLEGSGISF
ADLFRLIAFYCISRDVLPFTLKLPYAISTAKTESQLEELAQLGLNFWSSSADNKPLNSPP
PHRPLPSAGICPASLRQLCLINGVHSIKTRTPSELECSQTNGALCFINPLFLKVHSQDLS
TGPKRPSTRTPNANGTERPRSPPPRPPPPAINSLHTSPGLSRTEPQTSMPETVNHSKHGN
VALLGTKPTPIPPPRLKKQASFLEAESSAKTLTARRPSRRSEPEPELELELEMGTAGHAG
GAPPRDAPGDCTRAPPPGSESQPPPCHGARQRLSDMSLSTSSSDSLEFDRSMPLYGYEAD
TTSSLEDYEGESDQETMAPPIKSKKKRNSSFVLPKLVKSQLRKMSGVFSSFMTPEKRMVR
RIAELSRDKCTYFGCLVQDYVSFLKENKECHVSSTDMLQTIRQFMTQVKNYLSQSSELDP
PIESLIPEDQIDVVLEKAMHKCILKPLKGHVEAMLKDFHTADGSWKQLKENLQLVRQRNP
QELGVFAPTPDLMELEKIKLKFMTMQKMYSPEKKVMLLLRVCKLIYTVMENNSGRMYGAD
DFLPVLTYVIAQCDMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQA
ARLLSSEARDTLRQWHKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTE
DVCQLCAEKFKVEDPEEYSLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRI
KSDPYGVIFQNGEDLTPS
Download sequence
Identical sequences F8WGD2
NP_083000.5.92730 ENSMUSP00000092053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]