SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000095580 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000095580
Domain Number 1 Region: 79-202
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.08e-29
Family L-aminoacid/polyamine oxidase 0.0019
Further Details:      
 
Domain Number 2 Region: 60-99,215-261
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.75e-19
Family FAD-linked reductases, N-terminal domain 0.02
Further Details:      
 
Domain Number 3 Region: 5-80
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000302
Family FAD-linked reductases, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000095580   Gene: ENSMUSG00000025464   Transcript: ENSMUST00000097967
Sequence length 274
Comment pep:novel chromosome:GRCm38:7:140125708:140134334:1 gene:ENSMUSG00000025464 transcript:ENSMUST00000097967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFPGPRVLVVGSGIAGLGAAQKLCSHRAAPHLRVLEATASAGGRIRSERCFGFLKEHQD
TFFEPPLPAKKAEAIKKLGFGTNNKIFLEFEEPFWEPDCQFIQVVWEDTSPLQDTALSLQ
DTWFKKLIGFLVQPSFESSHVLCGFIAGLESEFMETLSDEEVLLSLTQVLRRVTGNPQLP
AAKSVRRSQWHSAPYTRGSYSYVAVGSTGDDLDLMAQPLPEDGTGTQLQVLFAGEATHRT
FYSTTHGALLSGWREADRLVSLWDSQVEQSRPRL
Download sequence
Identical sequences Q3TXR6
XP_006536232.1.92730 ENSMUSP00000095580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]