SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096257 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096257
Domain Number 1 Region: 855-912
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000746
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 2 Region: 916-967
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 3 Region: 679-736
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 4 Region: 737-793
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000392
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 5 Region: 54-87
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 797-850
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000131
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 7 Region: 626-676
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096257   Gene: ENSMUSG00000032289   Transcript: ENSMUST00000098660
Sequence length 1018
Comment pep:known chromosome:GRCm38:9:59966931:60511035:-1 gene:ENSMUSG00000032289 transcript:ENSMUST00000098660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSYLTSCLSALSTLLLLLGSQLVCPQPSTEHRKVPQRMAVTEGTPEDSGSGSPGVWGSW
GPWSACSRSCSGGVMEQTRPCLPSSYRARGGSRPNGRALSITGHVVSAVRTSVPLHRSQE
DQRALAGSNASRQGPAVVRGSRHPQARGREPSERRSRTRGPIGPGKYGYGKAPYILPLQT
DTTHTPQRLRRQRPSSRHSRSQEASASKQGYRPPTHQFSHSQPLYQSDSGPRSGLPPSEA
SIYQLPLTHDQSYPAASSLFHRPELSSHHGARPHGAAQAFPQHLRSTAISCIGAYRQYKL
CNTNACPESGRSIREVQCASYNNKPFMGRFYEWEPFAEVKGNRKCELNCQATGYRFYVRQ
AEKVIDGTPCDQNGTAICVSGQCKSIGCDDFLGSDKVLDKCGVCGGDNTGCQVVSGVFKH
ALTSLGYHRVVEIPQGATKINITEMHKSNNYLALRSRSGRSIINGNWAIDRPGKYEGGGT
MFTYKRPNEVSSTAGESFLAEGPTNEILDVYMIHQQPNPGVHYEYVIMRNNAISPQVPPH
RRPGEPFNGQLEEEDRGQEDREEREKNQEKEDSQVEAPEVFTSESTQTFPVRHPERFPSH
RPDNLVPPAPQPPRRSRDHNWKQLGTTECSTTCGKGSQYPIFRCVHRNTHEEVPESYCDS
SMKPTPEEEPCNLFPCPAFWDIGEWSECSKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQ
HLEKPETTSTCQLKICSEWQIRTDWTSCSVPCGVGQRTRDVKCVSNIGDMVHDEECNMKL
RPNDIENCDMGPCAKSWFLTEWSERCSAECGAGVRTRSVVCMTNHVSSLPLEGCGNNRPV
EATPCDNGPCTGKVEWFTGSWSQCSIECGSGTQQREVICVRKNADTFEVLDPYECSFLEK
PPSQQACHLKPCGAKWFSTEWSMCSKSCQGGFRVREVRCLSDDMTPSSLCDPQLKPEERE
SCNTQDCVPEVDENCKDKYYNCNVVVQARLCVYNYYKTACCASCTRVANRHVGFLGSR
Download sequence
Identical sequences Q3UTY6
ENSMUSP00000096257 ENSMUSP00000131418 ENSMUSP00000096257 10090.ENSMUSP00000096257 NP_001035516.2.92730 XP_006510969.1.92730 XP_006510970.1.92730 ENSMUSP00000034829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]