SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096421 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096421
Domain Number 1 Region: 467-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 58-119
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-25
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 523-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 691-748
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.57e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 411-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 579-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 637-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 733-785
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 358-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000619
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 10 Region: 286-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000243
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096421   Gene: ENSMUSG00000030386   Transcript: ENSMUST00000098822
Sequence length 794
Comment pep:known chromosome:GRCm38:7:12478293:12496235:1 gene:ENSMUSG00000030386 transcript:ENSMUST00000098822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAINPWPSWGTLMDQSWGMAAPEPSVSWALCPQDPAWHMEGSAEEDGRKTGGLPVAQVE
EPVTFKDVAVAFTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQGEE
PWSVEQGYPKSSCPEWMRNTESKALIPAQSVSEEEQSSNGMMLERYIWDNPWLSRLGVLG
YGDQLEMYHMNQSTGMRQMVFMQKQVLSQRGSEFCELGTEYSQSLNLIPSQRVSQLERFY
KPDTHLESWSCNSAIMYADKVTCENSDYNKAFCQSVQPVYPAKMQTGDNLFKCTDAVKSF
NHIIQFGDHKAVHTGEKLYGYKEYHQIFNQSPSLIEYPKLQIGGNQYEKYKEYENIFYFS
SFMEHQKIGSVEKTYKYNEWEKVFGYDSLLTQHTSTYTAEKPYEFNKCGTSFIWSSYLIQ
HKKTHPGEKPYECDKCGKVFRNRSALTKHERTHTGVKPYECNKCGKAFSWNSHLIVHTRI
HTGEKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGE
KPFKCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYN
CQECGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKC
GKSFSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAF
NESSSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICNQCGRAFSGHS
ALLQHQKNHSEEKL
Download sequence
Identical sequences Q7TSV0
NP_080388.2.92730 10090.ENSMUSP00000096421 ENSMUSP00000096421 ENSMUSP00000096421 ENSMUSP00000096421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]