SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096584 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096584
Domain Number 1 Region: 445-471,502-741
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.08e-62
Family Nuclear receptor ligand-binding domain 0.00000000175
Further Details:      
 
Domain Number 2 Region: 392-470
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-23
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096584   Gene: ENSMUSG00000031870   Transcript: ENSMUST00000098986
Sequence length 761
Comment pep:known chromosome:GRCm38:9:8900468:8965425:1 gene:ENSMUSG00000031870 transcript:ENSMUST00000098986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPEIKAGDSSGTGAGQKVLPKGLSPPRQLLLPTSGSAHWPGAGVKPSPQPAAGEVEED
SGLETEGSAAPLLKSKPRALEGTGSGGGVAANAASAAPGGVTLVPKEDSRFSAPRVSLEQ
DSPIAPGRSPLATTVVDFIHVPILPLNHALLAARTRQLLEGDSYDGGATAQGPFAPPRGS
PSAPSPPVPCGDFPDCTYPLEGDPKEDVFPLYGDFQTPGLKIKEEEEGADAAVRSPRPYL
SAGASSSTFPDFPLAPAPQRAPSSRPGEAAVAGGPSSAAVSPASSSGSALECILYKAEGA
PPTQGSFAPLPCKPPAAGSCLLPRDSLPAAPATAAAPAIYQPLGLNGLPQLGYQAAVLKD
SLPQVYPPYLNYLRPDSEASQSPQYGFDSLPQKICLICGDEASGCHYGVLTCGSCKVFFK
RAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRTLD
GVALPQSVGLPNESQALGQRITFSPNQEIQLVPPLINLLMSIEPDVVYAGHDNTKPDTSS
SLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVS
GQMLYFAPDLILNEQRMKELSFYSLCLTMWQIPQEFVKLQVTHEEFLCMKVLLLLNTIPL
EGLRSQSQFEEMRSSYIRELIKAIGLRQKGVVPSSQRFYQLTKLLDSLHDLVKQLHLYCL
NTFIQSRTLAVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Download sequence
Identical sequences ENSMUSP00000096584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]