SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097812 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097812
Domain Number 1 Region: 105-266,361-667
Classification Level Classification E-value
Superfamily Ras GEF 2.22e-124
Family Ras GEF 0.00017
Further Details:      
 
Domain Number 2 Region: 782-876
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.46e-41
Family Ras-binding domain, RBD 0.00000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097812   Gene: ENSMUSG00000026821   Transcript: ENSMUST00000100241
Sequence length 907
Comment pep:novel chromosome:GRCm38:2:28533542:28552636:1 gene:ENSMUSG00000026821 transcript:ENSMUST00000100241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQRMWAEAAGPIGGTEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRL
ESSTQEIGEELINGVIYSISLRKVQLHQGATKGQRWLGCENESALNLYETCKVRTVKAGT
LEKLVEHLVPAFQGSDLSYVTVFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCIL
PYSSEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERR
AHLLLAQLEDLEPSEAESEALSPAPVLSLKPASQLEPALLLTPSQVVTSTPVREPAAAPV
PVLASSPVVAPAPELEPVPEPPQEPEPSLALAPELEPAVSQSLELESAPVPTPALEPSWS
LPEATENGLTEKPHLLLFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLA
PTIRATVAQFNNVANCVITTCLGDQSMKAPDRARVVEHWIEVARECRALKNFSSLYAILS
ALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNP
RRAQRRQKETGVIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKL
LQSACNNYSIAPEEHFGTWFRAMERLSEAESYTLSCELEPPSESASNTLRSKKSTAIVKR
WSDRQAPSTELSTSSSAHSKSCDQLRCSPYLGSGDITDALSVHSAGSSSSDVEEINMSFV
PESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVSTTRTHKRSVSGVCSYSS
SLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPTVIRKAMDKHNLDEDEPEDYE
LVQIISEDHKLKIPENANVFYAMNSTANYDFILKKRTFTKGAKVKHGASSTLPRMKQKGL
RIAKGIF
Download sequence
Identical sequences Q3TWC1
NP_001139307.1.92730 ENSMUSP00000097812 ENSMUSP00000115092 ENSMUSP00000097812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]