SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099764 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099764
Domain Number 1 Region: 501-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 2 Region: 54-114
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 445-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 613-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 557-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 390-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.99e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 659-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.3e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 322-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000162
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 9 Region: 296-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000844
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099764   Gene: ENSMUSG00000037001   Transcript: ENSMUST00000102703
Sequence length 718
Comment pep:known chromosome:GRCm38:11:58888153:58904225:-1 gene:ENSMUSG00000037001 transcript:ENSMUST00000102703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNLQPDSVENSLSQLPSRCLETRKRKRSYKKRPVTYSYWRRTQRNRARKHKAPVKGLVS
FEDVSVDFTWDEWQDLDDSQRKLYRDVMLETYSSLESLGHCITKPEVIFKLEQGAEPWRA
EDVPKQSRADVQKITELNETSQDNEERHLWHHAITYSNKSTEEKVKLGNIVNVSSNCVSN
LTVKNGNSSGMRPVALTVWQSVLPPNKPDDTRIGEELDASLTSEPPIHAEHPGLYSRAPG
TGQQFQCCMQEVTCNTKALWTKRFHIAHGSSKFGESEKVPDEVALHAQDVSWVRAETFEC
SICKKTFCTKCELMKHKKIHKGQQYYTCRDCEKTFIKESYHTDQRVHAGVGSHRCKQCEK
CFHQKNQQNVHERVPREARLWEVYQSENSFGEKPNLRRYQRTRAGYKPYGCNLCGKAFYR
KSHLGRHQKIHTGEKPYGCEECKKTFYHKSSLTIHQRTHTGEKPYECKKCRKTFYCKSDL
NVHHRTHTGEKPYECDECRKTFYSKSHLVIHQKVHTGDKPYECEECQKAFSRKSNLTVHQ
KTHTGEKPYECNVCGKTFHRQSHLNMHQGTHTGQKPYQCEECGKAFYQKSSLRRHQRNHT
GSRPYACEECRKTFLHKSSLTVHQRSHTGYKPYSCEECRKTFYSKSHLTVHQRTHTGEKP
YECKLCKKAFHQKSYLNRHQVTHGSEKRFECQECRKTFYHKSSLTVHQRIHLRELLCV
Download sequence
Identical sequences Q02525
10090.ENSMUSP00000099764 ENSMUSP00000099764 NP_035888.2.92730 ENSMUSP00000099764 ENSMUSP00000099764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]