SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099937 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099937
Domain Number 1 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family Laminin-type module 0.081
Further Details:      
 
Domain Number 2 Region: 354-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 410-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 4 Region: 457-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000271
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000099937
Domain Number - Region: 24-43,85-182
Classification Level Classification E-value
Superfamily Sialidases 0.000108
Family Endo-alpha-sialidase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099937   Gene: ENSMUSG00000035513   Transcript: ENSMUST00000102873
Sequence length 530
Comment pep:known chromosome:GRCm38:2:29194821:29248040:-1 gene:ENSMUSG00000035513 transcript:ENSMUST00000102873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLLALFLHCLPLVSGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDREDEGLATYWQSVTWSRYPSPLE
ANITLSWNKSVELTDDVVVTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSPSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRMESA
KGLKEFFTFTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCTVRE
GSLQCECEHNTTGPDCGRCKKNFRTRAWRAGSYLPLPHGSPNACAAAGSAFGNCECYGHS
NRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHD
RCNETGFCECREGAVGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCQQNQRCACPP
GYTGIRCEQPRCDLADDAGPDCDRAPGIVPRPDTLLGCLLLLGLAARLAC
Download sequence
Identical sequences A2AKW8
NP_598007.1.92730 ENSMUSP00000099937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]