SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000100007 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000100007
Domain Number - Region: 16-110
Classification Level Classification E-value
Superfamily DNA clamp 0.0118
Family DNA polymerase processivity factor 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000100007   Gene: ENSMUSG00000076430   Transcript: ENSMUST00000102943
Sequence length 276
Comment pep:known chromosome:GRCm38:13:30946573:30947759:-1 gene:ENSMUSG00000076430 transcript:ENSMUST00000102943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFRARITSKRFIELFIQVSSTVAKLAKVCVLRVCPDRLYFCPMGLLGEAQLWGEMRRDV
FHHFCMEGASQEFNEICLELMSEHLARAVKNAGNASSLKLQLTNKQRPCLTLVVELASCP
GHTRAVVHDLPVRVLPRRRWKDCTEPHVRGSDVSVYLPALKTLKNMVERMANVGSHVLVE
ANLNGRMNLTVETDRVTIKSYFKNLGNPPNAVLCMSQGRDPETMVQVRVDNRKLLQCFDG
HQINPTMALCNILSNTLLHLVLVHEDISLQYFIPAS
Download sequence
Identical sequences Q059L7 Q8K572
ENSMUSP00000100007 ENSMUSP00000100007 NP_694712.1.92730 10090.ENSMUSP00000100007 ENSMUSP00000100007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]