SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000100927 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000100927
Domain Number 1 Region: 167-181,322-577
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-59
Family Nuclear receptor ligand-binding domain 0.000092
Further Details:      
 
Domain Number 2 Region: 99-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-29
Family Nuclear receptor 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000100927   Gene: ENSMUSG00000005897   Transcript: ENSMUST00000105290
Sequence length 590
Comment pep:known chromosome:GRCm38:10:94148023:94197211:1 gene:ENSMUSG00000005897 transcript:ENSMUST00000105290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHEGSTPGKVFLT
TPDAAGVNQLFFTSPDLSAPHLQLLTEKSPDQGPNKVFDLCVVCGDKASGRHYGAITCEG
CKGFFKRSIRKNLVYSCRGSKDCVINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEV
SREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETARSAGLLDSGMFVNIHPSGIKTE
PAMLMAPDKAESCQGDLSTLASVVTSLANLGKAKDLSHCGGDMPVVQSLRNGDTSFGAFH
HDIQTNGDVSRAFDTLAKALTPGESSACQSPEEGMEGSPHLIAGEPSFVEKEGPLLSESH
VAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQENSISLVKAYWNEL
FTLGLAQCWQVMNVATILATFVNCLHSSLQQDKMSPERRKSLMEHIFKLQEFCNSMVKLC
IDGHEYAYLKAIVLFSPDHPGLENMELIERFQEKAYVEFQDYITRTYPDDTYRLSRLLLR
LPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQIIGHSL
Download sequence
Identical sequences Q505F1
ENSMUSP00000089858 ENSMUSP00000096945 ENSMUSP00000100927 ENSMUSP00000089858 10090.ENSMUSP00000089858 ENSMUSP00000089858 NP_035759.3.92730 XP_006513655.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]