SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000100933 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000100933
Domain Number 1 Region: 261-487
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.57e-63
Family Nuclear receptor ligand-binding domain 0.00000000105
Further Details:      
 
Domain Number 2 Region: 136-211
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.32e-27
Family Nuclear receptor 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000100933   Gene: ENSMUSG00000047638   Transcript: ENSMUST00000105296
Sequence length 488
Comment pep:known chromosome:GRCm38:10:89454234:89506658:-1 gene:ENSMUSG00000047638 transcript:ENSMUST00000105296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMQFQGLENPIQISLHHSHRLSGFVPEGMSVKPAKGMLTEHAAGPLGQNLDLESYSPYN
NVPFPQVQPQISSSSYYSNLGFYPQQPEDWYSPGIYELRRMPAETGYQGETEVSEMPVTK
KPRMAAASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNC
VMDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTANEDDS
EGRDLRQVTSTTKFCREKTELTADQQTLLDYIMDSYNKQRMPQEITNKILKEEFSAEENF
LILTEMATSHVQILVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPAGH
ADLLEERIRKSGISDEYITPMFSFYKSVGELKMTQEEYALLTAIVILSPDRQYIKDREAV
EKLQEPLLDVLQKLCKMYQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPL
LCEIWDVQ
Download sequence
Identical sequences Q60641
ENSMUSP00000100933 NP_001157172.1.92730 ENSMUSP00000100934 10090.ENSMUSP00000100933 ENSMUSP00000100933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]