SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000100934 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000100934
Domain Number 1 Region: 247-473
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.91e-63
Family Nuclear receptor ligand-binding domain 0.00000000105
Further Details:      
 
Domain Number 2 Region: 122-197
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.01e-27
Family Nuclear receptor 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000100934   Gene: ENSMUSG00000047638   Transcript: ENSMUST00000105297
Sequence length 474
Comment pep:novel chromosome:GRCm38:10:89454373:89533585:-1 gene:ENSMUSG00000047638 transcript:ENSMUST00000105297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLIGHSHLQATDEFSLSESLFGMLTEHAAGPLGQNLDLESYSPYNNVPFPQVQPQISSS
SYYSNLGFYPQQPEDWYSPGIYELRRMPAETGYQGETEVSEMPVTKKPRMAAASAGRIKG
DELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECR
LRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTANEDDSEGRDLRQVTSTTKF
CREKTELTADQQTLLDYIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATSHVQIL
VEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPAGHADLLEERIRKSGIS
DEYITPMFSFYKSVGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKL
CKMYQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
Download sequence
Identical sequences ENSMUSP00000100934 NP_001156976.1.92730 XP_006513454.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]