SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101213 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101213
Domain Number 1 Region: 239-265,306-420
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.26e-37
Family Nuclear receptor ligand-binding domain 0.0000018
Further Details:      
 
Domain Number 2 Region: 186-266
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.75e-29
Family Nuclear receptor 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101213   Gene: ENSMUSG00000019768   Transcript: ENSMUST00000105588
Sequence length 499
Comment pep:putative chromosome:GRCm38:10:4710155:4967336:1 gene:ENSMUSG00000019768 transcript:ENSMUST00000105588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAY
EFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQ
LSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIM
ESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKS
CQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPL
VIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVH
MINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDREHSV
KTLKRSSDKDLQGLQTTGIPLCQAEDGLLLKNATRVQEKPTCSLHSLTKAKRACHVILVP
SPESRNVGVKDSTLLVVNS
Download sequence
Identical sequences D3Z6V3
ENSMUSP00000101213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]