SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101940 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101940
Domain Number 1 Region: 527-637
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-19
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 168-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-16
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 3 Region: 343-459
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000157
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 4 Region: 289-351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000524
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 643-701
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000144
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 703-764
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 771-829
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000433
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 8 Region: 465-530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000243
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101940   Gene: ENSMUSG00000030683   Transcript: ENSMUST00000106333
Sequence length 923
Comment pep:known chromosome:GRCm38:7:126950729:126970596:1 gene:ENSMUSG00000030683 transcript:ENSMUST00000106333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPKAQHPPPSQLLLLILLSCAWIEGLPLKEDEMMPEPGSETPTVASEDLAELLHGALL
RKGPEIGFLPGSDPDPTLATPPAGQTLAAPSLPRATEPGTGPLTTAVTPKGVRGAGPTAP
ELLTPPPGTTAPPPPGPASPVPPLRPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEG
EGFVESPDLGSTASRSVELLDCTYSIHVYPGYGIEIQVQTLNLSQEEELLVLAGGGSPGL
APRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGNGFRIHYQAYLLSCGFPPRPAHGD
VSVTDLHPGGTATFHCDSGYQLQGEETLICLNGTRPAWTGEPPSCTASCGGTIHNATLGR
IVSPEPGGAAGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDS
DMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFPPFLAHGNVTTTDPE
FHPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLS
PDWPQSYSPGQDCVWGLHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQ
PRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHG
DLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEITNGHRTASD
AGFPVGSHVQYRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENG
YQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVAYEELLDNRK
LEVTQTTDPSRQLEGGNLALAILLPLGLVIVLGIGVYIYYTKLQGKSLFGFSGSHSYSPI
TVESDFSNPLYEAGDTREYEVSI
Download sequence
Identical sequences NP_659175.1.92730 ENSMUSP00000101942 ENSMUSP00000101940 ENSMUSP00000032921 10090.ENSMUSP00000101940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]