SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102274 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102274
Domain Number 1 Region: 133-460
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9.38e-54
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000269
Further Details:      
 
Domain Number 2 Region: 464-600
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.86e-20
Family Ricin B-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102274   Gene: ENSMUSG00000038296   Transcript: ENSMUST00000106663
Sequence length 607
Comment pep:novel chromosome:GRCm38:7:111471661:111779977:-1 gene:ENSMUSG00000038296 transcript:ENSMUST00000106663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPVPDKKLEEDKGDTL
KIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRVALKQFQYY
GYNAYLSDRLPLDRPLPDLRPSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAMER
TPSHLLKEIILVDDNSSNEELKEKLTEYVDKVNGQKPGFIKVVRHSKQEGLIRSRVSGWR
AATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSFDNIKYDNFEIEEYPLAAQGF
DWELWCRYLNPPKAWWKLENSTAPIRSPALIGCFIVDRQYFEEIGLLDEGMEVYGGENVE
LGIRVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMA
WNIPQEDSGIDIGDITARKALRKQLQCKTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKTD
LCLDQGPDTENVPIVYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRL
IECSYAKAKRMKLHWQFSQGGSIQNRKSKRCLELQENSDMEFGFQLVLQKCSGQHWTITN
VLRSLVS
Download sequence
Identical sequences Q59J91
ENSMUSP00000102274 XP_006507721.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]