SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102526 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102526
Domain Number 1 Region: 276-460
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-67
Family SPRY domain 0.000000165
Further Details:      
 
Domain Number 2 Region: 4-74
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-22
Family RING finger domain, C3HC4 0.0073
Further Details:      
 
Domain Number 3 Region: 81-143
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-17
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102526   Gene: ENSMUSG00000030966   Transcript: ENSMUST00000106913
Sequence length 462
Comment pep:known chromosome:GRCm38:7:102557922:102565469:-1 gene:ENSMUSG00000030966 transcript:ENSMUST00000106913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLR
PNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHT
RVPIEEAAKVYQEKIHVALEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFAL
QNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELL
QEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISK
DRRQVRMGDTHQNVSDNEERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQ
RKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITD
HGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM
Download sequence
Identical sequences Q3U7K7
ENSMUSP00000033264 ENSMUSP00000102526 ENSMUSP00000033264 NP_001076021.1.92730 NP_033303.3.92730 ENSMUSP00000033264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]