SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102720 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102720
Domain Number 1 Region: 26-188
Classification Level Classification E-value
Superfamily RUN domain-like 3.01e-45
Family RUN domain 0.0000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102720   Gene: ENSMUSG00000006575   Transcript: ENSMUST00000107103
Sequence length 400
Comment pep:novel chromosome:GRCm38:11:102393403:102401754:1 gene:ENSMUSG00000006575 transcript:ENSMUST00000107103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASFVQTTMALGLPSKKASSRNVIVERRNLITVCRFSVKTLLEKYTAEPIDDSSEEFVN
FAAILEQILSHRFKGPASWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAKG
RAWIRVALMEKRMSEYITTALRDNRTTRRFYDSGAIMLREEATVLTGMLIGLSAIDFSFC
LKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDED
SWYNKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKR
ELEGVILELQEQLTGLIPGDHAPLAQGSKELTTSLVNQWPSLSTLHRPEGASNSKLYRRH
SFMSTEPLSAEASLSSDSQRLGEAKRDEEPWGPIGSSEPN
Download sequence
Identical sequences XP_006533757.1.92730 ENSMUSP00000102720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]