SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000102736 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000102736
Domain Number 1 Region: 245-345
Classification Level Classification E-value
Superfamily HMG-box 5.89e-24
Family HMG-box 0.00000155
Further Details:      
 
Domain Number 2 Region: 518-616
Classification Level Classification E-value
Superfamily HMG-box 2.49e-22
Family HMG-box 0.00000362
Further Details:      
 
Domain Number 3 Region: 103-185
Classification Level Classification E-value
Superfamily HMG-box 2.36e-21
Family HMG-box 0.00000347
Further Details:      
 
Domain Number 4 Region: 354-432
Classification Level Classification E-value
Superfamily HMG-box 5.37e-17
Family HMG-box 0.00000922
Further Details:      
 
Domain Number 5 Region: 443-522
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000144
Family HMG-box 0.00000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000102736   Gene: ENSMUSG00000020923   Transcript: ENSMUST00000107119
Sequence length 727
Comment pep:known chromosome:GRCm38:11:102305993:102317287:-1 gene:ENSMUSG00000020923 transcript:ENSMUST00000107119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAF
KDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYF
RFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFR
EDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDEIMRDYIQKHPELNISEEGI
TKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQ
KEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQTTSPASKKPSQ
EGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYK
AREAALKAQSERKPGGEREDRGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEM
TWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQK
FSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQRQYKVHLDLWVKSL
SPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQSKSESEEDDDEEEEDDEEEEEEEDD
ENGDSSEDGGDSSESSSEDESEDGDENDDDDDDEDDEDDDDEDEDNESEGSSSSSSSSGD
SSDSDSN
Download sequence
Identical sequences A2AWT6
NP_001037848.1.92730 NP_001289883.1.92730 XP_011247193.1.92730 XP_017169919.1.92730 XP_017169920.1.92730 ENSMUSP00000102732 ENSMUSP00000102734 ENSMUSP00000102736 ENSMUSP00000136310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]