SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103229 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103229
Domain Number 1 Region: 30-213
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.28e-38
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 2 Region: 267-333
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000023
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 635-707
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000136
Family VWC domain 0.029
Further Details:      
 
Domain Number 4 Region: 427-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000311
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 479-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000123
Family EGF-like domain of nidogen-1 0.054
Further Details:      
 
Domain Number 6 Region: 549-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family EGF-type module 0.017
Further Details:      
 
Domain Number 7 Region: 334-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000628
Family VWC domain 0.038
Further Details:      
 
Domain Number 8 Region: 514-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000914
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000103229
Domain Number - Region: 577-640
Classification Level Classification E-value
Superfamily FnI-like domain 0.00115
Family VWC domain 0.032
Further Details:      
 
Domain Number - Region: 392-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00537
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 718-755
Classification Level Classification E-value
Superfamily FnI-like domain 0.0199
Family VWC domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103229   Gene: ENSMUSG00000055409   Transcript: ENSMUST00000107603
Sequence length 763
Comment pep:novel chromosome:GRCm38:7:49975334:50863358:1 gene:ENSMUSG00000055409 transcript:ENSMUST00000107603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMDVILVLWFCVCTARTVLGFGMDPDLQMDIITELDLVNTTLGVTQVAGLHNASKAFLF
QDVQREIHSAPHVSEKLIQLFRNKSEFTFLATVQQKPSTSGVILSIRELEHSYFELESSG
PREEIRYHYIHGGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPET
NLPPGSNLWLGQRNQKHGFFKGIIQDGKIIFMPNGFITQCPNLNRTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLGQLENCHCEKTCQVSGLLYRDQDSWVDGDNCRNCTCKSG
AVECRRMSCPPLNCSPDSLPVHISGQCCKVCRPKCIYGGKVLAEGQRILTKTCRECRGGV
LVKITEACPPLNCSEKDHILPENQCCRVCRGHNFCAEAPKCGENSECKNWNTKATCECKN
GYISVQGNSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCIPGYIRVDDFSCTEHDDC
GSGQHNCDKNAICTNTVQGHSCTCQPGYVGNGTVCKAFCEEGCRYGGTCVAPNKCVCPSG
FTGSHCEKDIDECALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKHNGQVW
ILREDRCSVCSCKDGKIFCRRTACDCQNPNVDLFCCPECDTRVTSQCLDQSGQKLYRSGD
NWTHSCQQCRCLEGEADCWPLACPSLSCEYTAIFEGECCPRCVSDPCLADNIAYDIRKTC
LDSSGISRLSGAVWTMAGSPCTTCQCKNGRVCCSVDLVCLENN
Download sequence
Identical sequences D3YWD8
ENSMUSP00000103229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]