SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103528 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103528
Domain Number 1 Region: 462-632
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-50
Family SPRY domain 0.00049
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 2.21e-20
Family RING finger domain, C3HC4 0.0057
Further Details:      
 
Domain Number 3 Region: 147-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000198
Family B-box zinc-binding domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103528   Gene: ENSMUSG00000000275   Transcript: ENSMUST00000107896
Sequence length 634
Comment pep:known chromosome:GRCm38:11:88999376:89020293:1 gene:ENSMUSG00000000275 transcript:ENSMUST00000107896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELNPLAEELSCSVCLELFKEPVTTPCGHNFCMSCLDETWVVQGPPYRCPQCRKVYQVR
PQLQKNTVMCAVVEQFLQAEQARTPVDDWTPPARFSASSAATQVACDHCLTEIAVKTCLV
CMASFCQEHLRPHFDSPAFQDHPLQSPIRDLLRRKCTQHNRLRELFCPEHGECICHICLV
EHKTCSPTTLSQASADLEYKLRNKLTIMHSHINGATKALEDVRSKQQCVQDSMKRKMEQL
RQEYMEMKAVIDAAETSSLRKLKEEEKRVYGKFDTIYQVLVKKKSEMQKLKAEVELIMDK
GDEFEFLEKAAKLQGESTKPVYIPKIDLDHDLIMGIYQGAADLKSELKHSIKKLQKKSEE
HNGSGNKGDQTQSTFKPVQPSKKTIQEKKTKKTPVAPGPPSHFSPNKLPTFGAPGQSLDS
KATSPDAAPKASAAQPDSVGVKAKVLENFLTKSRTELLEYFVKVIFDYNTAHNKVSLSNK
YTTASVSDGLQHYRSHPQRFTYCSQVLGLHCYKNGIHYWEVELQKNNFCGVGICYGSMER
QGPESRLGRNPNSWCVEWFNNKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVTE
KVHLMYKFKVDFTEALYPAFWVFSAGTTLSICSK
Download sequence
Identical sequences Q61510
10090.ENSMUSP00000103528 NP_033572.2.92730 ENSMUSP00000000284 ENSMUSP00000103528 ENSMUSP00000103528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]