SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103544 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103544
Domain Number 1 Region: 202-442
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-70
Family Nuclear receptor ligand-binding domain 0.00000000048
Further Details:      
 
Domain Number 2 Region: 73-160
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.44e-26
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103544   Gene: ENSMUSG00000060601   Transcript: ENSMUST00000107911
Sequence length 443
Comment pep:novel chromosome:GRCm38:7:44549617:44553948:-1 gene:ENSMUSG00000060601 transcript:ENSMUST00000107911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPTSSLDTPVPGNGSPQPSTSATSPTIKEEGQETDPPPGSEGSSSAYIVEPEDEPERK
RKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVHGGAGRYACRGSGTCQ
MDAFMRRKCQLCRLRKCKEAGMREQCVLSEEQIRKKRIQKQQQQQPPPPSEPAASSSGRP
AASPGTSEASSQGSGEGEGIQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADP
QSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETAR
RYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINI
FSADRPNVQEPSRVEALQQPYVEALLSYTRIKRPQDQLRFPRMLMKLVSLRTLSSVHSEQ
VFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences Q8BP65
NP_001272447.1.92730 NP_001272448.1.92730 ENSMUSP00000103543 ENSMUSP00000103544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]