SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103620 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103620
Domain Number 1 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 727-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 45-103
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.45e-21
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 5 Region: 783-840
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 604-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-20
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 7 Region: 560-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-19
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 8 Region: 676-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 339-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-16
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 11 Region: 829-881
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000557
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103620   Gene: ENSMUSG00000012640   Transcript: ENSMUST00000107986
Sequence length 886
Comment pep:putative chromosome:GRCm38:7:43296523:43313255:-1 gene:ENSMUSG00000012640 transcript:ENSMUST00000107986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLEGFGFATKKTSRTEDRGAMAADPNFQQKSQPLGAEEQPESCERWMSFEDVTVNFSQE
EWQHLDSAQRCLYQEVMLEIYSHLLAVGYSIPSPGVIFRMEKGKEAQTAKAEFPGQRCQE
KSGNDTLPQKASGKTSVYSNVASEVTRDGSWCSLLQELWQGADITKRGQQNQILLFPPGS
FLKKTLSKNSDHEYQKPRETIPLGPYLISTQEGLPQYHSLPKSLDVSLGANGHNERDQLI
DIVASSQLLIPGSCNANCVVTHGGEESYRSTGNGDVLSHKQPLIYGNRFQVKADQSSQCQ
EVLYAISLHKPEITLTVDRPIVSYNGGKAFLYVSDSLSHPFQLKVDRVVHTGGDPYKCSS
CEKSFCNAAALQQHEQIHTEEKLYVCTLCGKAFSDGSAFYEHELIHKNHTPFICDICGKA
FLRKSELTSHKQCHNGEKPYKCNDCEKSFKFPSQLKVHHQIHTGEKPYECRECGKSFSKT
AKLKVHQRIHTGEKPYVCSQCGKAFNQKSILDRHEKLHPGEKPYKCNDCGKSFNYPSQLK
VHCHSHTGEKPYKCHECGKSFNFPCELKVHYQNHTGEKPYKCRECWKLFSKMSQLKAHYR
VHTGERPYKCSHCGKAFSTKEQVQEHERIHTGEKPFVCTECGKAFSSRSSFRKHQLIHTK
EKPFVSQKCETGLQEATLIPHQQLHIGEKPYKCPDCGKLFNYPSQLKSHYQIHTGEKPCK
CPDCGKSFSKTSQLKAHSRIHTGERPYVCSVCGKAFKQLSTLSRHEKIHMVEKPYKCSFC
GKSFCSPSELKVHLLIHTGERPYKCSSCWKAFCTKVQLQEHERIHTGERPYVCTHCGKAF
RSRSVFSKHKLIHRKETPFICERCGKVFLQKSELTSHLQTHIEDKP
Download sequence
Identical sequences G3X9T1
NP_081540.3.92730 XP_006541243.1.92730 XP_006541245.1.92730 XP_006541246.1.92730 XP_006541247.1.92730 XP_006541248.1.92730 10090.ENSMUSP00000040282 ENSMUSP00000040282 ENSMUSP00000103620 ENSMUSP00000040282 ENSMUSP00000040282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]