SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105050 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105050
Domain Number 1 Region: 204-467
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-81
Family Nuclear receptor ligand-binding domain 0.000000000257
Further Details:      
 
Domain Number 2 Region: 99-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-27
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105050   Gene: ENSMUSG00000022383   Transcript: ENSMUST00000109423
Sequence length 468
Comment pep:known chromosome:GRCm38:15:85735564:85802163:1 gene:ENSMUSG00000022383 transcript:ENSMUST00000109423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSIGEESSGSFGFADYQYLGSC
PGSEGSVITDTLSPASSPSSVSCPVIPASTDESPGSALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDLKDSETADLKSLGKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV
IHDMETLCMAEKTLVAKMVANGVEDKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT
FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
Download sequence
Identical sequences P23204 Q542P9
NP_001106889.1.92730 NP_035274.2.92730 XP_006520682.1.92730 XP_006520683.1.92730 XP_006520684.1.92730 XP_006520685.1.92730 XP_006520686.1.92730 XP_011243818.1.92730 XP_011243819.1.92730 XP_011243821.1.92730 10090.ENSMUSP00000059719 ENSMUSP00000059719 ENSMUSP00000059719 ENSMUSP00000059719 ENSMUSP00000105049 ENSMUSP00000105050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]