SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105537 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105537
Domain Number 1 Region: 668-865
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.64e-50
Family Nuclear receptor ligand-binding domain 0.000000512
Further Details:      
 
Domain Number 2 Region: 600-673
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-26
Family Nuclear receptor 0.0000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105537   Gene: ENSMUSG00000031618   Transcript: ENSMUST00000109911
Sequence length 867
Comment pep:novel chromosome:GRCm38:8:76902476:77243663:1 gene:ENSMUSG00000031618 transcript:ENSMUST00000109911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKGYHSLPEGLDMERRWSQVSQTLERSSLGPAERTNENSYMEIVNVSCVSGATPNNST
QGSSKEKHELLPCLQQDNSRSGILPSDIKTELESKELSATVAESMGLYMDSVRDAEYTYD
QQNQQGSLSPAKIYQNMEQLVKFYKENGHRSSTLSAISRPLRSFMPDSGTSMNGGALRAI
VKSPIICHEKSPSVCSPLNMPSSVCSPAGINSMSSSTASFGSFPVHSPITQGTSLTCSPS
VENRGSRSHSPVHASNVGSPLSSPLSSMKSPISSPPSHCSVKSPVSSPNNVPLRSSVSSP
ANLNNSRCSVSSPSNTNNRSTLSSPTASTVGSIGSPISNAFSYTTSGASAGAGAIQDMVP
SPDTHEKGAHDVPFPKTEEVEKAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNNKINPS
SPFSVPIKQESSKHSCSGASFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DSSCEGSAFPGGIKQEPDDGSYFPETSIPSSAIIGVNSGGQSFHYRIGAQGTISLSRSPR
DQSFQHLSSFPPVNALVESWKPHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNLGGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNE
EKMHQSAMYELCQGMRQISLQFVRLQLTFEEYSIMKVLLLLSTVPKDGLKSQAAFEEMRT
NYIKELRKMVTKCPNSSGQSWQRFYQLTKLLDSMHDLVNDLLEFCFYTFRESQALKVEFP
AMLVEIISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences D3Z473
ENSMUSP00000105537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]