SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105538 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105538
Domain Number 1 Region: 732-978
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-63
Family Nuclear receptor ligand-binding domain 0.000000073
Further Details:      
 
Domain Number 2 Region: 600-678
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.32e-27
Family Nuclear receptor 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105538   Gene: ENSMUSG00000031618   Transcript: ENSMUST00000109912
Sequence length 980
Comment pep:known chromosome:GRCm38:8:76902288:77245007:1 gene:ENSMUSG00000031618 transcript:ENSMUST00000109912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKGYHSLPEGLDMERRWSQVSQTLERSSLGPAERTNENSYMEIVNVSCVSGATPNNST
QGSSKEKHELLPCLQQDNSRSGILPSDIKTELESKELSATVAESMGLYMDSVRDAEYTYD
QQNQQGSLSPAKIYQNMEQLVKFYKENGHRSSTLSAISRPLRSFMPDSGTSMNGGALRAI
VKSPIICHEKSPSVCSPLNMPSSVCSPAGINSMSSSTASFGSFPVHSPITQGTSLTCSPS
VENRGSRSHSPVHASNVGSPLSSPLSSMKSPISSPPSHCSVKSPVSSPNNVPLRSSVSSP
ANLNNSRCSVSSPSNTNNRSTLSSPTASTVGSIGSPISNAFSYTTSGASAGAGAIQDMVP
SPDTHEKGAHDVPFPKTEEVEKAISNGVTGQLNIVQYIKPEPDGAFSSSCLGGNNKINPS
SPFSVPIKQESSKHSCSGASFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPGF
DSSCEGSAFPGGIKQEPDDGSYFPETSIPSSAIIGVNSGGQSFHYRIGAQGTISLSRSPR
DQSFQHLSSFPPVNALVESWKPHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNLGARKSKKLGKLKGLHEEQPQQPPPPPPQSPEEGTTYIAPTKEPSVNSALV
PQLASITRALTPSPSMILENIEPEIVYAGYDNSKPDTAESLLSTLNRLAGKQMIQVVKWA
KVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSA
MYELCQGMRQISLQFVRLQLTFEEYSIMKVLLLLSTVPKDGLKSQAAFEEMRTNYIKELR
KMVTKCPNSSGQSWQRFYQLTKLLDSMHDLVNDLLEFCFYTFRESQALKVEFPAMLVEII
SDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences A3KN90
NP_001077375.1.92730 XP_006530637.1.92730 XP_006530638.1.92730 XP_006530639.1.92730 XP_006530640.1.92730 ENSMUSP00000105538 ENSMUSP00000105539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]