SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105542 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105542
Domain Number 1 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-25
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 219-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 500-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 555-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 331-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-21
Family KRAB domain (Kruppel-associated box) 0.00016
Further Details:      
 
Domain Number 8 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 9 Region: 597-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 10 Region: 111-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.99e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 11 Region: 184-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000454
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 12 Region: 56-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000821
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105542   Gene: ENSMUSG00000068130   Transcript: ENSMUST00000109916
Sequence length 667
Comment pep:known chromosome:GRCm38:2:150407141:150451486:-1 gene:ENSMUSG00000068130 transcript:ENSMUST00000109916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVVTYDDVHVNFTQEEWALLDSSQKNLYRDVMLETYRNLAAIGYSWEDHNPEEHFQSSR
RHGRHEKSHIEEKPSEFTQCGKVFAYQSHPQGHQQIHTGEKPYEVIQYLEAFAYHSSLQI
HKRTHGGDKHYKINECGKAFACHNSLQRYKRVHTGEKLYECNQCGTDFAQHSHLQQHERM
HTVKCKQSGKDFACYTNLQIYQRTHTGEKPYECIFCDKTFIHHSHLERHERIHTGEKPYE
CNQCGKAFSQNSSLQLHKRTHTGEKPYECKQCGKSFACQSGLQQHKKTHHGEKSYECKRC
GKAFACQSDLQQHKRTHTGEKSYECNQCDKAFALRCHLRRHQRIHTVEKPYKCNQCGKFF
AQSNHFVRHKRTHTGEKPYECNQCDKAFACQTSLLYHKRTHSGEKLYVCNECGKAFVLQS
YLQIHKRTHTGEKPFGCDQCDKAFAQNSHLLTHKRTHTGEKPYECEQCGKAFASNSNLQV
HKKTHTGEKPYECKQCGKAFGFQSGLQKHKRTHTGEKPYECNQCDKAFACQASLLNHKRS
HTGEKPYECSECGKAFVLHSYLQIHKRIHTGEKPFECDQCDKAFARNTLLLKHKRIHTGQ
KPYGCKQCGKAFANHSNLQVHKRTHTGEKPYECKHCGKPFKCQSGLQYHKRTQHIQERNP
MTVINVI
Download sequence
Identical sequences A2AQA0
10090.ENSMUSP00000105542 NP_001297574.1.92730 ENSMUSP00000105542 ENSMUSP00000105542 ENSMUSP00000105542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]