SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105618 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000105618
Domain Number - Region: 141-282
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000628
Family Terpene synthases 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105618   Gene: ENSMUSG00000020432   Transcript: ENSMUST00000109991
Sequence length 430
Comment pep:known chromosome:GRCm38:11:3917192:3932078:-1 gene:ENSMUSG00000020432 transcript:ENSMUST00000109991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLKALLLLSGVFGALAEFCVIPRIDSQLVEKLGQRLLPWMDRLSSEQLNPSVFVGLRL
SSMQAGTKEDLYLHSLKIHYQQCLLRSTSSDDNSSCQPKLSGGSLALYLLALRANCEFFG
SRKGDRLISQLKWFLEDEKKAIGHNHEGHPNTNYYQYGLSILALCVHQKRLHDSVVGKLL
YAVEHDYFTYQGHVSVDTEAMAGLALTCLERFNFNSDLRPRITMAIETVREKILKSQAPE
GYFGNIYSTPLALQMLMTSPASGVGLGTACIKAGTSLLLSLQDGAFQNPLMISQLLPILN
HKTYLDLIFPDCQASRVMLVPAVEDPVHISEVISVTLKVASALSPYEQTFFVFAGSSLED
VLKLAQDGGGFTYGTQASLSGPYLTSVLGKDAGDREYWQLLRAPDTPLLQGIADYKPQDG
ETIELRLVRW
Download sequence
Identical sequences O88968
ENSMUSP00000020710 ENSMUSP00000020710 10090.ENSMUSP00000105616 NP_001123930.1.92730 NP_001123931.1.92730 NP_056564.1.92730 XP_006514673.1.92730 XP_006514674.1.92730 XP_006514675.1.92730 XP_006514676.1.92730 ENSMUSP00000020710 ENSMUSP00000105615 ENSMUSP00000105616 ENSMUSP00000105617 ENSMUSP00000105618 ENSMUSP00000105619 ENSMUSP00000105620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]