SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105708 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105708
Domain Number 1 Region: 365-460
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 6.67e-36
Family Small-conductance potassium channel 0.00000694
Further Details:      
 
Domain Number 2 Region: 234-407
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000105708
Domain Number - Region: 436-516
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0123
Family Outer membrane efflux proteins (OEP) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105708   Gene: ENSMUSG00000002908   Transcript: ENSMUST00000110081
Sequence length 539
Comment pep:known chromosome:GRCm38:8:70842049:70857008:-1 gene:ENSMUSG00000002908 transcript:ENSMUST00000110081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSHSHNGSVGQPLGSGPGFLGWEPVDPEAGRPLQPTQGPGLQMVAKGQPVRLSPGGSRG
HPQEQEEEEEEEEEEEDKTGSGKPPTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMV
TETELSWGVYTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMT
WERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYLLA
RVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVR
VCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVV
AVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRK
HQRKFLQAIHQFQKRLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEAR
LAALESRLDVLGASLQALPGLIAQAICPLPPPWPGPGHLATATQSPQSHWLPTMGSDCG
Download sequence
Identical sequences Z4YL28
ENSMUSP00000105708 ENSMUSP00000105708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]