SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105808 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105808
Domain Number 1 Region: 24-183
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-31
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105808   Gene: ENSMUSG00000027333   Transcript: ENSMUST00000110179
Sequence length 243
Comment pep:novel chromosome:GRCm38:2:131491943:131525172:1 gene:ENSMUSG00000027333 transcript:ENSMUST00000110179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAARALLEQGFTDVTVLEASSHI
GGRVQSVRLGDTTFELGATWIHGSHGNPIYQLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNRGCRIPKDVVEEFSDLYNEVYNMTQEFFRHGKPVNAESQNSVGVFTREKVRNRI
RDDPDDTEATKRLKLAMIQQYLKGTPIYQNLGESCAQPGAATHTSGVPIPTHRWAQVGRM
WRS
Download sequence
Identical sequences A2ANQ4
NP_001171310.1.92730 ENSMUSP00000105808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]