SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105818 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105818
Domain Number 1 Region: 24-266,306-381
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.47e-55
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 361-457
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.62e-17
Family L-aminoacid/polyamine oxidase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105818   Gene: ENSMUSG00000027333   Transcript: ENSMUST00000110189
Sequence length 512
Comment pep:novel chromosome:GRCm38:2:131491943:131525172:1 gene:ENSMUSG00000027333 transcript:ENSMUST00000110189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAARALLEQGFTDVTVLEASSHI
GGRVQSVRLGDTTFELGATWIHGSHGNPIYQLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNRGCRIPKDVVEEFSDLYNEVYNMTQEFFRHGKPVNAESQNSVGVFTREKVRNRI
RDDPDDTEATKRLKLAMIQQYLKVESCESSSHSIDEVSLSAFGEWTEIPGAHHIIPSGFM
RVVELLAEGIPPHVIQLGKPVRCIHWDQASAHPRGPEIEPRGEGDHNHDTGEGGQSGENP
QQGRWDEDEPWPVVVECEDCEVIPADHVIVTVSLGVLKRQYTSFFRPCLPTEKVAAIHRL
GIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESCTLTYPPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMERCDDEAVAEICTEMLRQFTAHAGALLRGGHTPQVLLHHPRCSA
LWPARGRPAHRDVPRPLPAGALKGVLTAKCVP
Download sequence
Identical sequences ENSMUSP00000105818 NP_001171306.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]