SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105832 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105832
Domain Number 1 Region: 195-373
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-44
Family Nuclear receptor ligand-binding domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 121-207
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.26e-30
Family Nuclear receptor 0.00000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105832   Gene: ENSMUSG00000021255   Transcript: ENSMUST00000110203
Sequence length 378
Comment pep:putative chromosome:GRCm38:12:86421644:86515522:1 gene:ENSMUSG00000021255 transcript:ENSMUST00000110203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSELCIPDPLGYHNQLLNRMSSEDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSS
DASGGFGIALSTHANGLDSPPMFAGAGLGGNPCRKSYEDCTSGIMEDSAIKCEYMLNAIP
KRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYNCPATNECEITKRRRKSCQACR
FMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGV
EQDKLYAMPPNDIPEGDIKALTTLCELADRELVFLINWAKHIPGFPSLTLGDQMSLLQSA
WMEILILGIVYRSLPYDDKLAYAEDYIMDEEHSRLVGLLDLYRAILQLVRRYKKLKVEKE
EFMILKALALANSGKGGT
Download sequence
Identical sequences D3YW03
ENSMUSP00000105832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]