SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106222 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106222
Domain Number 1 Region: 203-345
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 100-205
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-33
Family Second domain of FERM 0.0000869
Further Details:      
 
Domain Number 3 Region: 18-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-27
Family First domain of FERM 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106222   Gene: ENSMUSG00000027238   Transcript: ENSMUST00000110592
Sequence length 570
Comment pep:novel chromosome:GRCm38:2:121548307:121806992:-1 gene:ENSMUSG00000027238 transcript:ENSMUST00000110592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGI
RFVDPDKQRHWLEFTKSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRD
LYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHK
TELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHF
IKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSS
QVRTVSSSNLFFKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPR
LSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSSSHGDTFLPHVRSSRADSNERVAVIA
DEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEAEALGGELR
ALCQGHGGSEQEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDVAFFRDIRQTPE
FEQFHYQYFCPLRRWFACKIRSVVSLLIDT
Download sequence
Identical sequences A2AR56
ENSMUSP00000120176 10090.ENSMUSP00000106222 ENSMUSP00000106222 XP_006499332.1.92730 ENSMUSP00000106222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]