SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106783 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106783
Domain Number 1 Region: 198-300
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000986
Further Details:      
 
Domain Number 2 Region: 66-172
Classification Level Classification E-value
Superfamily SRCR-like 9.42e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 353-457
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000776
Further Details:      
 
Domain Number 4 Region: 482-585
Classification Level Classification E-value
Superfamily SRCR-like 7.19e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106783   Gene: ENSMUSG00000029699   Transcript: ENSMUST00000111153
Sequence length 586
Comment pep:known chromosome:GRCm38:5:135960211:135974531:-1 gene:ENSMUSG00000029699 transcript:ENSMUST00000111153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPSERPSIGWTPKEAEMQIGPQPDGWSRGWKPGDRGAVPLPLSPALSFLLLFPLASALQ
PTPLPFPELRLVGGPSRCRGRLEVMHSGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPR
PLAFGQGRGPIFLDNVECRGQEASLSECGSRGWGVHNCFHYEDVAVLCDEFLHTQPPTRK
VLTSMAPATALQNGKGEGSVRLVGGASPCQGRVEILHGGVWGTVCDDDWGLQDAAVVCRQ
LGCGVALAATTNAFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGHHEDAGVLCA
VLSPPTSTALPPSVTKEDWARHTGPAATGVGASPSRDTVWLTTAARASGKKSGRLRLVGG
PSPCRGRVEVLYAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLD
NVGCTGTEARLSDCFHLGWGQHNCGHHEDAGALCAGPEELGLQVQQAGSETTRMPSPRPR
DGHLRLASGTHRCEGRVELFLGQRWGTVCDDAWDLRAAIVLCRQLGCGQALAAPGEAHFG
PGRGPILLDNVKCRGDESTLLLCSHIRWDVHNCDHSEDASVLCQPL
Download sequence
Identical sequences A1L0T3
ENSMUSP00000106782 MmR258 10090.ENSMUSP00000106782 NP_001153838.1.92730 XP_006504400.1.92730 ENSMUSP00000050439 ENSMUSP00000106782 ENSMUSP00000106783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]