SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106987 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106987
Domain Number 1 Region: 235-383
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-44
Family Nuclear receptor ligand-binding domain 0.0000000892
Further Details:      
 
Domain Number 2 Region: 93-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.17e-29
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106987   Gene: ENSMUSG00000002108   Transcript: ENSMUST00000111355
Sequence length 385
Comment pep:novel chromosome:GRCm38:2:91184092:91194885:-1 gene:ENSMUSG00000002108 transcript:ENSMUST00000111355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWLEASMPDVSPDSATELWKTEPQDAGDQGGNTCILREEARMPQSTGVALGIGLESAE
PTALLPRAETLPEPTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFF
RRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQ
EEEQAQATSVSPRVSSPPQVLPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTVMLLET
SRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAI
SIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDPLMFPRMLMKLVSLRTLSSVHS
EQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences A2AGR4
ENSMUSP00000106987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]