SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106988 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106988
Domain Number 1 Region: 204-443
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.29e-71
Family Nuclear receptor ligand-binding domain 0.000000000719
Further Details:      
 
Domain Number 2 Region: 93-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.0000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106988   Gene: ENSMUSG00000002108   Transcript: ENSMUST00000111356
Sequence length 445
Comment pep:known chromosome:GRCm38:2:91184061:91195035:-1 gene:ENSMUSG00000002108 transcript:ENSMUST00000111356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWLEASMPDVSPDSATELWKTEPQDAGDQGGNTCILREEARMPQSTGVALGIGLESAE
PTALLPRAETLPEPTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFF
RRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQ
EEEQAQATSVSPRVSSPPQVLPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPIAP
DPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLET
SRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAI
SIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDPLMFPRMLMKLVSLRTLSSVHS
EQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences Q91X41 Q9Z0Y9
ENSMUSP00000002177 10090.ENSMUSP00000002177 NP_001171201.1.92730 NP_038867.2.92730 XP_006499229.1.92730 XP_006499230.1.92730 XP_006499231.1.92730 ENSMUSP00000002177 ENSMUSP00000106986 ENSMUSP00000106988 ENSMUSP00000002177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]