SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107421 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107421
Domain Number 1 Region: 9-297
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-46
Family WD40-repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 1002-1060
Classification Level Classification E-value
Superfamily HMG-box 0.0000000641
Family HMG-box 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107421   Gene: ENSMUSG00000037572   Transcript: ENSMUST00000111791
Sequence length 1118
Comment pep:known chromosome:GRCm38:14:47240944:47276832:-1 gene:ENSMUSG00000037572 transcript:ENSMUST00000111791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATQKPMRYGHTEGHTEVCFDDSGSYIVTCGSDGDVRMWEDLDDDDPKSVNVGEKAFSC
ALKNGKLVTAVSNNTVQVYTFPEGVPDGILTRFTTNANHVVFNGAGNKIAAGSSDFLVKV
VDVMDNSQQQTFRGHDAPVLSLSFDPKDIFLASASCDGTVRVWNISDQTCAVSWPVLQKS
NDVVNAKSICRLAWQPKAGKLLAVPVEKSVKLYRRETWSNPFDLSDSSISQTLNIVTWSP
CGQYLAAGAINGLIVVWNVETKDCMERVKHEKGYAICGLAWHPTCSRICYTDVEGNLGVL
ENVCDLSGKVSSNKVSSRVEKDYNDLFDGDDTSSAGDFLNDNAVEIPSFSKGIINEDDDN
DDIMLAADHDLGDDENSVDVTMLKADLSHKEEGDDDQARSIHNLPLIRPQRPFYDGPMPT
PRQKPFQSSSTPLHLSHRFMVWNSVGIIRCYNDDQDSAIDVEFHDTSIHHATHLLNAFNY
TMGTLSHEAILLACESADELASKLHCLHFSSWDSSKEWMVDMPQNEDIEAICLGLGWAAA
ATTALLLRLFTIGGVQKEVFCLPGPVVSMAGHGEQLCIVYHRGTGFDGDQCLGVQLLELG
RKKNQVLHGDPLPLTRKSYLTWLGFSAEGTPCYVDSEGCVRMLNRGLGNTWTPVCNIREH
CKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAILSFKLPYCQTSTEKGQMEE
QFWHSVLFHNYLDYLAKNGYDYEESIKNQAVKEQQELLMKMLALSCKLEREFRCVELADL
MTQNAVHLAIKYASRSRKLILAQKLSELAAEKAAELAETQSEEEKEEDFREKLNAGYSHT
TTEWSRPRVRSQVEDAEDREDTVSEEKPESHNHGQNLFQSANSSDTPALKSGAVFSSSQG
WVNPFKVVVSSKEPAVSANSTRSANILDSMNKSSRKSTSLNRMENNEKSPVIKPLTPKPR
SKQASAASYFQKRTPQADKTEEVKENPKSSSSDAPAVCLQNSENQRPKTGFQMWLEENRS
QILSDNPDISDETDIIKEGMIRFRVLSAEERKAWTNKAKGETASDGAEAKKRKRVVSEIC
ETENQEETVKENLDLSKKQKALNLPANQKLSAFAFKQE
Download sequence
Identical sequences A0A2K6EDP7
ENSMUSP00000107421 XP_006518893.1.92730 ENSMUSP00000107420 10090.ENSMUSP00000107421 ENSMUSP00000093638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]