SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108235 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108235
Domain Number 1 Region: 465-792
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.31e-61
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000263
Further Details:      
 
Domain Number 2 Region: 798-925
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.09e-18
Family Ricin B-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108235   Gene: ENSMUSG00000026828   Transcript: ENSMUST00000112616
Sequence length 930
Comment pep:known chromosome:GRCm38:2:57997884:58039878:1 gene:ENSMUSG00000026828 transcript:ENSMUST00000112616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKIRKFFRGSGRVLAFIFAASVIWLLFDMAALRLSFSEINAGLLKEDIIRREHTGFRVE
PDQVKVLYTSIRGMGLPRNGAWGKENFRKAENHELKVEENMDQVQRKGKMQNLLGRRKAV
PLWHLAHLQTLPVTIPMQKTQGRDSKPEVSSQYMMSKWMTVLESEKTPFTASRGVPLTKI
AGRTETFDKKQEAPQNYNVSSDTSKQASERTLNMTISVKTDRSKQKSQTVTKLRMHFASP
PILKSEEVTVIKKAEAQSKDLKHEALKALPLLKFIADMGHLKNQSTNETQLGRLPEDDAA
KVAPGKKLNFSESHVVIITKEEELKTDTKEVPNSKTQTVFPKLLGGSPHKQIPRNQSKTS
SSPPALKKAVSQSKPTISGGLHTARSNLTAKAPTVGYQQSHANIPENPGMHHVFRIDVTL
SPRDLNAPGQFGRPVVVPPEKKKEAEQRWKEGNFNVYLSDLIPVDRAIEDTRPAGCAEQL
VHNDLPTTSIIMCFVDEVWSALLRSVHSVLNRSPPHLIKEILLVDDFSTKEYLKADLDKY
MSQFPKVRILRLKERHGLIRARLAGAQNATGDVLTFLDSHVECNVGWLEPLLERVYLNRK
KVACPVIEVINDKDMSYMTVDNFQRGVFTWPMNFGWKTIPPDVVAKNGIKETDIIRCPVM
AGGLFSIDKSYFYELGTYDPGLDVWGGENMELSFKVWMCGGEIEIIPCSRVGHIFRNDNP
YSFPKDRMKTVERNLVRVAEVWLDDYRELFYGHGDHLIDQGLDVGNLTQQRELRKKLKCK
SFKWYLDNVFPDLKAPVVRASGVLINMALGKCVSIENITVTLEDCDGSSQLQQFNYTWVR
LIKHGEWCVAPIPEKGSLTLYHCDNRNNRLKWLHKSASAFHPELVDHIVFENYQQLLCME
GNFSQKTLKLAACNPMELQQKWKFEKYYEV
Download sequence
Identical sequences Q8C102
NP_766443.2.92730 XP_006498111.1.92730 XP_006498112.1.92730 ENSMUSP00000108235 10090.ENSMUSP00000028171 ENSMUSP00000108235 ENSMUSP00000108235 ENSMUSP00000131362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]