SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108237 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108237
Domain Number 1 Region: 54-181,212-329
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.96e-43
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.065
Further Details:      
 
Domain Number 2 Region: 637-711
Classification Level Classification E-value
Superfamily EF-hand 3.19e-16
Family Calmodulin-like 0.018
Further Details:      
 
Domain Number 3 Region: 310-404
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000049
Family D-aminoacid oxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108237   Gene: ENSMUSG00000026827   Transcript: ENSMUST00000112618
Sequence length 745
Comment pep:known chromosome:GRCm38:2:57238297:57370719:1 gene:ENSMUSG00000026827 transcript:ENSMUST00000112618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAVKGTILVGGGALATVLGLSPFAHYRRKQVSLAYVEAAGYLTEPVNREPPSREAQ
LMTLKNTPEFDILVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMNLDVEQYRMVKEALHERANLLEIAPHLSAPLPIMLPLYKWWQLPYYWVGIKMY
DLVAGSQCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPETGKERVSGARCKDVLTGQEFDVRAKCVINASGPFTDSVRKM
DDKNVVPICQPSAGVHIVMPGYYSPENMGLLDPATSDGRVIFFLPWEKMTIAGTTDTPTD
VTHHPIPSEEDINFILNEVRNYLSSDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISDSGLITIAGGKWTTYRSMAEDTVDAAVKFHNLNAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAKTYGDKAFEVAKMASVTGKRWPVVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWSELRKQCVTYDSDGSTV
ATSWSSQEELETATRFLYYEMGYKSRTEQLTDSTEISLLPSDIDRYKKRFHKFDEDEKGF
ITIVDVQRVLESINVQMDENTLHEILCEVDLNKNGQVELHEFLQLMSAVQKGRVSGSRLA
ILMKTAEENLDRRVPIPVDRSCGGL
Download sequence
Identical sequences A2AQR0
ENSMUSP00000108237 ENSMUSP00000028167 10090.ENSMUSP00000108237 ENSMUSP00000108237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]