SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108248 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108248
Domain Number 1 Region: 334-596
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-72
Family Nuclear receptor ligand-binding domain 0.000000000112
Further Details:      
 
Domain Number 2 Region: 261-339
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-28
Family Nuclear receptor 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108248   Gene: ENSMUSG00000026826   Transcript: ENSMUST00000112629
Sequence length 598
Comment pep:known chromosome:GRCm38:2:57106830:57124003:-1 gene:ENSMUSG00000026826 transcript:ENSMUST00000112629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSV
YYKPSSPPTPSTPSFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQ
SPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHA
SQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQDPSPPSP
PVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW
AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVT
FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences Q06219 Q3TYI4
ENSMUSP00000028166 ENSMUSP00000028166 ENSMUSP00000108248 NP_001132981.1.92730 NP_038641.1.92730 XP_011237335.1.92730 XP_011237336.1.92730 XP_021048829.1.100879 XP_021048830.1.100879 XP_021048831.1.100879 ENSMUSP00000028166 10090.ENSMUSP00000108248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]