SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108253 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108253
Domain Number 1 Region: 94-420
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.47e-68
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000000248
Further Details:      
 
Domain Number 2 Region: 469-587
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.88e-26
Family Ricin B-like 0.0000222
Further Details:      
 
Domain Number 3 Region: 423-486
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000036
Family Ricin B-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108253   Gene: ENSMUSG00000060988   Transcript: ENSMUST00000112634
Sequence length 592
Comment pep:known chromosome:GRCm38:2:54436387:55118309:1 gene:ENSMUSG00000060988 transcript:ENSMUST00000112634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEM
GKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVV
IVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTLEVPVKII
RMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVI
SDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRN
YFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHV
INKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD
SQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVHDLCLSAPSLGVGA
EECCSNHPLYGLVYTPTINEQVFSYTADKEIRTDDLCLDVSRLSGPVIMLKCHHMRGNQL
WEYDAERLTLRHANSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMTLGT
Download sequence
Identical sequences ENSMUSP00000108253 ENSMUSP00000108253 ENSMUSP00000108253 10090.ENSMUSP00000108253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]