SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108254 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108254
Domain Number 1 Region: 94-420
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.91e-68
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000000248
Further Details:      
 
Domain Number 2 Region: 423-552
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.14e-42
Family Ricin B-like 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108254   Gene: ENSMUSG00000060988   Transcript: ENSMUST00000112635
Sequence length 556
Comment pep:known chromosome:GRCm38:2:54436387:55118309:1 gene:ENSMUSG00000060988 transcript:ENSMUST00000112635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEM
GKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVV
IVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTLEVPVKII
RMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVI
SDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRN
YFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHV
INKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD
SQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDL
CLDVSRLSGPVIMLKCHHMRGNQLWEYDAERLTLRHANSNQCLDEPSEEDKMVPTMQDCS
GSRSQQWLLRNMTLGT
Download sequence
Identical sequences A2RRI8 Q8CF93
ENSMUSP00000063464 ENSMUSP00000108254 ENSMUSP00000108255 NP_766618.2.92730 XP_006498154.1.92730 XP_006498155.1.92730 XP_021047841.1.100879 XP_021047842.1.100879 XP_021047843.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]