SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108498 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108498
Domain Number 1 Region: 145-156,247-481
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.91e-50
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 72-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108498   Gene: ENSMUSG00000063972   Transcript: ENSMUST00000112877
Sequence length 495
Comment pep:known chromosome:GRCm38:2:38723370:38927688:-1 gene:ENSMUSG00000063972 transcript:ENSMUST00000112877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERDERPPSGGGGGGGSAGFLEPPAALPPPPRNGFCQDELAELDPGTNGETDSLTLGQGH
IPVSVPDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMS
RKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEFEEE
ANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSSRSVELNGFMAFRDQYMGMSVPPHYQY
IPHLFSYSGHSPLLPPQARSLDPQSYSLIHQLMSAEDLEPLGTPMLIEDGYAVTQAELFA
LLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELA
DVTAKYSPSDEELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGL
TSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLPLL
FKVVLHSCKTSTVKE
Download sequence
Identical sequences Q64249
10090.ENSMUSP00000108498 ENSMUSP00000075624 ENSMUSP00000075624 ENSMUSP00000108498 IGBMC-1019-000 NP_034394.1.92730 ENSMUSP00000075624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]