SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000109952 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000109952
Domain Number 1 Region: 231-480
Classification Level Classification E-value
Superfamily Caspase-like 2.24e-54
Family Caspase catalytic domain 0.00033
Further Details:      
 
Domain Number 2 Region: 95-188
Classification Level Classification E-value
Superfamily DEATH domain 4.94e-21
Family DEATH effector domain, DED 0.011
Further Details:      
 
Domain Number 3 Region: 10-79
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000107
Family DEATH effector domain, DED 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000109952   Gene: ENSMUSG00000026031   Transcript: ENSMUST00000114313
Sequence length 481
Comment pep:known chromosome:GRCm38:1:58711560:58758884:1 gene:ENSMUSG00000026031 transcript:ENSMUST00000114313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSPVSAEVIHQVEECLDEDEKEMMLFLCRDVTENLAAPNVRDLLDSLSERGQLSFATL
AELLYRVRRFDLLKRILKTDKATVEDHLRRNPHLVSDYRVLLMEIGESLDQNDVSSLVFL
TRDYTGRGKIAKDKSFLDLVIELEKLNLIASDQLNLLEKCLKNIHRIDLNTKIQKYTQSS
QGARSNMNTLQASLPKLSIKYNSRLQNGRSKEPRFVEYRDSQRTLVKTSIQESGAFLPPH
IREETYRMQSKPLGICLIIDCIGNDTKYLQETFTSLGYHIQLFLFPKSHDITQIVRRYAS
MAQHQDYDSFACVLVSLGGSQSMMGRDQVHSGFSLDHVKNMFTGDTCPSLRGKPKLFFIQ
NYESLGSQLEDSSLEVDGPSIKNVDSKPLQPRHCTTHPEADIFWSLCTADVSHLEKPSSS
SSVYLQKLSQQLKQGRRRPLVDLHVELMDKVYAWNSGVSSKEKYSLSLQHTLRKKLILAP
T
Download sequence
Identical sequences O35732 Q812G4
ENSMUSP00000065107 ENSMUSP00000109952 NP_001276633.1.92730 NP_997536.1.92730 XP_006495698.1.92730 XP_011236722.1.92730 XP_011236723.1.92730 XP_011236724.1.92730 XP_011236725.1.92730 XP_017169048.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]