SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110241 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110241
Domain Number 1 Region: 1142-1337
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.000026
Further Details:      
 
Domain Number 2 Region: 932-1055
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-31
Family Pleckstrin-homology domain (PH domain) 0.000000589
Further Details:      
 
Domain Number 3 Region: 36-161
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110241   Gene: ENSMUSG00000036591   Transcript: ENSMUST00000114594
Sequence length 1949
Comment pep:novel chromosome:GRCm38:2:20847919:20968881:-1 gene:ENSMUSG00000036591 transcript:ENSMUST00000114594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMATHWTGLPEEDGDKLKACGVSKNKDGKDQGEPVSPSEDEPFSWPGPKTVMLKRTSQGF
GFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCT
GDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQD
AYLKGNEAYSGNARNIPEPPPVCYPWLPSTPSATAQPVETCPPDSLPNKQQTSAPVLTQP
GRAYRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLANRNNPSGPSHRTEE
VRYGVNEQASTKAASRTTSPASVPTAHLIHQTTGSRSLEPSGILLKSGNYSGHSEGISSS
RSQAVDSPPVSVNHYSANSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQS
AADYNQVVPTRTTLQVRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGAL
TSPPVSFNNHRTRSWDYIEGQTEATATVNSESQIPDSNGERKQTYKWSGFTEQDDRRGIH
ERPRQQEMHKPFRGSNLTVAPVVNSDNRRLVGRGVGPVSQFKKIPPDLRPPHSNRNFPTT
TGVSLQRGIAQDRSPLVKVRSNSLKVPPPPVSKPSFSQHSLASMKDQRPVNHLHQHSVLS
QQTQFRSESTFEHQLETEVSSCLPGTSAKTSPQLSENLGTSDLELPAIPRNGDINLQEAE
IQQPDVLDNKESVILREKPQSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARREVH
IKRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHEIAHIPASAVISASTAHVPSIATVP
PSLTTSAPLIRRQLSHDQESVGPPSLDGQHSSKTERSKSYDEGLDDYREDAKLSFKHVSS
LKGIKITDSQKSSEDSGSRKGSSSEVFSDAAREGWLQFRPLVTDKGKRVGGSIRPWKQMY
VVLRGHSLYLYKDRREQTTPSEEEQPISVNACLIDISYSETKRRNVFRLTTSDCECLFQA
EDRDDMLSWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLLSKTEQLPKTPRQSLSIR
QTLLGAKSEPKTQSPHSPKEESERKLLSKDDTSPPKDKGTWRRGIPSIVRKTFEKKPAAT
GTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELNKG
MADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLRTLKRL
IHDLPEHHFETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTHMP
DQYKIVETLIQHHDWFFTEEGAEEPLTAVQEENTVDSQPVPNIDHLLTNIGRTGVLPGDV
SDSATSDSAKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDSVFF
KKENTEQSHSEIKEESKRESETSGSKQRVVVAKESNTKKDSGTTKEEKKIPWEEPSPPHS
SKRNRSPTLSCRLAMLKEGPRSLLTQKPHCEETGSDSGTLLSTSSQASLLRSSTKKSTSP
ETKHSEFLSIAGTTTSDYSTTSSTTYLTSLDSSRLSPEVQSVAESKGDEADDERSELVSE
GRPVETDSESEFPVFPTTLTSDRLFRGKFQEVARVSRRNSEGSEASCTEGSLTPSLDSRR
QQFSSHRLIECDTLSRKKSARFKSDSGSPGDTRTEKETPALAKMFDVMKKGKSTGSLLTP
SRSESEKQEATWKTKIADRLKLRPRAPADDMFGVGNQKPTAETAKRKNIKRRHTLGGHRD
ATEISVLSFWKAHEQSADKESELSAVNRLKPKCSAQDLSISDWLARERVRTSASDLSRGE
GLEPQAESPSVLGTPISTHSPPSQQPEARVAATSTLASTSQSPLFTPPQSPDQINRESFQ
NMSQNASSTANIHPHKQSESPDTKAETPP
Download sequence
Identical sequences A0A0A0MQE8
ENSMUSP00000110241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]