SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110337 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110337
Domain Number 1 Region: 3821-3963
Classification Level Classification E-value
Superfamily SET domain 5.1e-48
Family Histone lysine methyltransferases 0.0044
Further Details:      
 
Domain Number 2 Region: 1466-1536
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000148
Family PHD domain 0.0092
Further Details:      
 
Domain Number 3 Region: 1566-1637
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000179
Family PHD domain 0.01
Further Details:      
 
Domain Number 4 Region: 1706-1770
Classification Level Classification E-value
Superfamily Bromodomain 0.00000942
Family Bromodomain 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000110337
Domain Number - Region: 1427-1479
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000908
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110337   Gene: ENSMUSG00000002028   Transcript: ENSMUST00000114689
Sequence length 3966
Comment pep:known chromosome:GRCm38:9:44803355:44881296:-1 gene:ENSMUSG00000002028 transcript:ENSMUST00000114689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPQAGGGGPGAPPSPPAV
AAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSAAI
GTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKASPRKPRGRPRSG
SDRNPAILSDPSVFSPLNKSETKSADKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDIA
ELTQGSKEDSLKKVKRTPSAMFQQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRR
RGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRIIP
SCKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRII
KTPRRFIEDEDYDPPMKIARLESTPNSRFSATSCGSSEKSSAASQHSSQMSSDSSRSSSP
SIDTTSDSQASEEIQALPEERSNTPEVHTPLPISQSPENESNDRRSRRYSMSERSFGSRA
TKKLPTLQSAPQQQTSSSPPPPLLTPPPPLQPASGISDHTPWLMPPTIPLASPFLPASAA
PMQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVG
FASGFSASGTAASARLFSPLHSGTRFDIHKRSPILRAPRFTPSEAHSRIFESVTLPSNRT
SSGASSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSTSELSPLTPPSSVSSSLSI
PVSPLAASALNPTFTFPSHSLTQSGESTEKNQRARKQTSALAEPFSSNSPALFPWFTPGS
QTEKGRKKDTAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSDIQSSS
ALYPVGRVSKEKVAGEDVGTSSSAKKATGRKKSSSLDSGADVAPVTLGDTTAVKAKILIK
KGRGNLEKNNLDLGPAAPSLEKERTPCLSAPSSSTVKHSTSSIGSMLAQADKLPMTDKRV
ASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKR
AVFPDDMPTLSALPWEEREKILSSMGNDDKSSVAGSEDAEPLAPPIKPIKPVTRNKAPQE
PPVKKGRRSRRCGQCPGCQVPEDCGICTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSK
ASLQKQTKAVKKKEKKSKTTEKKESKESTAVKSPLEPAQKAAPPPREEPAPKKSSSEPPP
RKPVEEKSEEGGAPAPAPAPEPKQVSAPASRKSSKQVSQPAAVVPPQPPSTAPQKKEAPK
AVPSEPKKKQPPPPEPGPEQSKQKKVAPRPSIPVKQKPKDKEKPPPVSKQENAGTLNILN
PLSNGISSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSG
HVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKC
RNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAK
LFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCESLSGTEDEMYEILSNLPESVA
YTCVNCTERHPAEWRLALEKELQASLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEE
SIPSRSSPEGPDPPVLTEVSKQDEQQPLDLEGVKKRMDQGSYVSVLEFSDDIVKIIQAAI
NSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSNNSGMLPNAVLPPSL
DHNYAQWQEREESSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDS
PELNPPPGIDDNRQCALCLMYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSL
KNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHR
DLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLS
DCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIMECRPPVVEPDINSTVEHDDNRTIAHS
PSSFIDASCKDSQSTAAILSPPSPDRPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGC
RPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPLRSKLRIMSPVRTGSAY
SRSSVSSVPSLGTATDPEASAKASDRGGLLSSSANLGHSAPPSSSSQRTVGGSKTSHLDG
SSPSEVKRCSASDLVPKGSLVKGEKNRTSSSKSTDGSAHSTAYPGIPKLTPQVHNATPGE
LNISKIGSFAEPSTVPFSSKDTVSYPQLHLRGQRSDRDQHMDPSQSVKPSPNEDGEIKTL
KLPGMGHRPSILHEHIGSSSRDRRQKGKKSSKETCKEKHSSKSYLEPGQVTTGEEGNLKP
EFADEVLTPGFLGQRPCNNVSSEKIGDKVLPLSGVPKGQSTQVEGSSKELQAPRKCSVKV
TPLKMEGENQSKNTQKESGPGSPAHIESVCPAEPVSASRSPGAGPGVQPSPNNTLSQDPQ
SNNYQNLPEQDRNLMIPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEED
IPFYSNSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFR
EEEQCDLPKISQLDGVDDGTESDTSVTATSRKSSQIPKRNGKENGTENLKIDRPEDAGEK
EHVIKSAVGHKNEPKLDNCHSVSRVKAQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTY
NAELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLTLGEGLGLD
SNREKDIGLFEVFSQQLPATEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQ
NPSRLAVISDSGEKRVTITEKSVASSEGDPALLSPGVDPAPEGHMTPDHFIQGHMDADHI
SSPPCGSVEQGHGNSQDLTRNSGTPGLQVPVSPTVPVQNQKYVPSSTDSPGPSQISNAAV
QTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSPVSSTPSVMETNTSVLGP
MGSGLTLTTGLNPSLPPSPSLFPPASKGLLSVPHHQHLHSFPAAAQSSFPPNISSPPSGL
LIGVQPPPDPQLLGSEANQRTDLTTTVATPSSGLKKRPISRLHTRKNKKLAPSSAPSNIA
PSDVVSNMTLINFTPSQLSNHPSLLDLGSLNPSSHRTVPNIIKRSKSGIMYFEQAPLLPP
QSVGGTAATAAGSSTISQDTSHLTSGPVSALASGSSVLNVVSMQTTAAPTSSTSVPGHVT
LANQRLLGTPDIGSISHLLIKASHQSLGIQDQPVALPPSSGMFPQLGTSQTPSAAAMTAA
SSICVLPSSQTAGMTAASPPGEAEEHYKLQRGNQLLAGKTGTLTSQRDRDPDSAPGTQPS
NFTQTAEAPNGVRLEQNKTLPSAKPASSASPGSSPSSGQQSGSSSVPGPTKPKPKAKRIQ
LPLDKGSGKKHKVSHLRTSSEAHIPHRDTDPAPQPSVTRTPRANREQQDAAGVEQPSQKE
CGQPAGPVAALPEVQATQNPANEQENAEPKAMEEEESGFSSPLMLWLQQEQKRKESITER
KPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGIL
HDAVVFLIEQLAGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRQSAFDMFNFLAS
KHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGL
FCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAAR
FINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKK
CRKFLN
Download sequence
Identical sequences P55200
ENSMUSP00000002095 10090.ENSMUSP00000110337 ENSMUSP00000110337 ENSMUSP00000110337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]